ZBED6 C-Terminal Like Antibody

Images

 
Western Blot: C7orf29 Antibody [NBP1-56604] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZBED6 C-Terminal Like Antibody Summary

Immunogen
Synthetic peptides corresponding to C7ORF29 The peptide sequence was selected from the middle region of C7ORF29. Peptide sequence VKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSH. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C7ORF29
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C7orf29 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZBED6 C-Terminal Like Antibody

  • chromosome 7 open reading frame 29
  • hypothetical protein LOC113763

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZBED6 C-Terminal Like Antibody (NBP1-56604) (0)

There are no publications for ZBED6 C-Terminal Like Antibody (NBP1-56604).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZBED6 C-Terminal Like Antibody (NBP1-56604) (0)

There are no reviews for ZBED6 C-Terminal Like Antibody (NBP1-56604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZBED6 C-Terminal Like Antibody (NBP1-56604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZBED6 C-Terminal Like Products

Bioinformatics Tool for ZBED6 C-Terminal Like Antibody (NBP1-56604)

Discover related pathways, diseases and genes to ZBED6 C-Terminal Like Antibody (NBP1-56604). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZBED6 C-Terminal Like

There are no specific blogs for ZBED6 C-Terminal Like, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZBED6 C-Terminal Like Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C7ORF29
Uniprot