ZADH2 Antibody

Images

 
Western Blot: ZADH2 Antibody [NBP1-56464] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZADH2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ZADH2(zinc binding alcohol dehydrogenase domain containing 2) The peptide sequence was selected from the N terminal of ZADH2. Peptide sequence FVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZADH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ZADH2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZADH2 Antibody

  • MGC45594
  • zinc binding alcohol dehydrogenase domain containing 2
  • zinc-binding alcohol dehydrogenase domain-containing protein 2

Background

The specific function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57578
Species: Hu
Applications: WB
NBP2-02164
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34852
Species: Hu, Mu
Applications: WB, IP
NBP1-93685
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-83838
Species: Hu
Applications: WB, IHC, IHC-P
NLS6168
Species: Hu, Pm, Pm
Applications: ICC/IF (-), IP (-), WB (-), WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow (-)

Publications for ZADH2 Antibody (NBP1-56464) (0)

There are no publications for ZADH2 Antibody (NBP1-56464).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZADH2 Antibody (NBP1-56464) (0)

There are no reviews for ZADH2 Antibody (NBP1-56464). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZADH2 Antibody (NBP1-56464) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZADH2 Products

Bioinformatics Tool for ZADH2 Antibody (NBP1-56464)

Discover related pathways, diseases and genes to ZADH2 Antibody (NBP1-56464). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZADH2 Antibody (NBP1-56464)

Discover more about diseases related to ZADH2 Antibody (NBP1-56464).
 

Pathways for ZADH2 Antibody (NBP1-56464)

View related products by pathway.

Blogs on ZADH2

There are no specific blogs for ZADH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZADH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZADH2
Uniprot