YPEL4 Antibody

Images

 
Immunohistochemistry: YPEL4 Antibody [NBP2-30393] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Product Discontinued
View other related YPEL4 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-30393
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

YPEL4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EQRLLLTGLHSVADIFCESCKTTLGWKYEQAFETSQKYKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YPEL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for YPEL4 Antibody

  • FLJ30213
  • MGC102723
  • MGC138324
  • protein yippee-like 4
  • yippee-like 4 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-30393
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for YPEL4 Antibody (NBP2-30393) (0)

There are no publications for YPEL4 Antibody (NBP2-30393).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YPEL4 Antibody (NBP2-30393) (0)

There are no reviews for YPEL4 Antibody (NBP2-30393). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for YPEL4 Antibody (NBP2-30393) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional YPEL4 Products

YPEL4 NBP2-30393

Bioinformatics Tool for YPEL4 Antibody (NBP2-30393)

Discover related pathways, diseases and genes to YPEL4 Antibody (NBP2-30393). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for YPEL4 Antibody (NBP2-30393)

View related products by pathway.

Blogs on YPEL4

There are no specific blogs for YPEL4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YPEL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YPEL4
Uniprot