Recombinant Human Xylulokinase/XYLB Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Xylulokinase/XYLB Peptides and Proteins

Order Details


    • Catalog Number
      H00009942-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Xylulokinase/XYLB Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-536 of Human XYLB full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTRGPPE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
XYLB

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 60 mM NaCl, 50% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Xylulokinase/XYLB Protein

  • EC 2.7.1.17
  • FLJ10343
  • FLJ12539
  • FLJ22075
  • XYLB
  • xylulokinase (H. influenzae) homolog
  • xylulokinase homolog (H. influenzae)
  • Xylulokinase
  • Xylulose Kinase

Background

The protein encoded by this gene shares 22% sequence identity with Hemophilus influenzae xylulokinase, and even higher identity to other gene products in C.elegans (45%) and yeast (31-35%), which are thought to belong to a family of enzymes that include fucokinase, gluconokinase, glycerokinase and xylulokinase. These proteins play important roles in energy metabolism. Multiple transcripts resulting from use of alternate polyadenylation sites have been noted for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87828
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-90233
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-45335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00000130-M01
Species: Hu
Applications: WB, ELISA
NBP2-02192
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29487
Species: Hu, Mu, Ha, Mk, Pm, Rb
Applications: IHC-P, ICC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
AF4636
Species: Mu
Applications: WB
NBP1-57033
Species: Hu
Applications: WB
7559-ST
Species: Hu
NBP1-59448
Species: Hu
Applications: WB

Publications for Xylulokinase/XYLB Recombinant Protein (H00009942-P01) (0)

There are no publications for Xylulokinase/XYLB Recombinant Protein (H00009942-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Xylulokinase/XYLB Recombinant Protein (H00009942-P01) (0)

There are no reviews for Xylulokinase/XYLB Recombinant Protein (H00009942-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Xylulokinase/XYLB Recombinant Protein (H00009942-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Xylulokinase/XYLB Products

Bioinformatics Tool for Xylulokinase/XYLB Recombinant Protein (H00009942-P01)

Discover related pathways, diseases and genes to Xylulokinase/XYLB Recombinant Protein (H00009942-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Xylulokinase/XYLB Recombinant Protein (H00009942-P01)

Discover more about diseases related to Xylulokinase/XYLB Recombinant Protein (H00009942-P01).
 

Pathways for Xylulokinase/XYLB Recombinant Protein (H00009942-P01)

View related products by pathway.

PTMs for Xylulokinase/XYLB Recombinant Protein (H00009942-P01)

Learn more about PTMs related to Xylulokinase/XYLB Recombinant Protein (H00009942-P01).
 

Research Areas for Xylulokinase/XYLB Recombinant Protein (H00009942-P01)

Find related products by research area.

Blogs on Xylulokinase/XYLB

There are no specific blogs for Xylulokinase/XYLB, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Xylulokinase/XYLB Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol XYLB
Entrez