XYLT2 Antibody

Images

 
Western Blot: XYLT2 Antibody [NBP1-69345] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle

Product Details

Summary
Product Discontinued
View other related XYLT2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69345
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

XYLT2 Antibody Summary

Immunogen
Synthetic peptides corresponding to XYLT2(xylosyltransferase II) The peptide sequence was selected from the C terminal of XYLT2. Peptide sequence LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN.
Clonality
Polyclonal
Host
Rabbit
Gene
XYLT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against XYLT2 and was validated on Western blot.
Theoretical MW
97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for XYLT2 Antibody

  • EC 2.4.2.26
  • Peptide O-xylosyltransferase 1
  • PXYLT2
  • XT2UDP-D-xylose:proteoglycan core protein beta-D-xylosyltransferase
  • xylosyltransferase 2
  • xylosyltransferase IIXT-IIprotein xylosyltransferase 2
  • xylT-II

Background

XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determination of sclerotic activity in systemic sclerosis.The protein encoded by this gene is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determination of sclerotic activity in systemic sclerosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82024
Species: Hu
Applications: IHC, IHC-P
NBP2-06677
Species: Hu
NBP1-90674
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86277
Species: Hu
Applications: IHC, IHC-P
H00000259-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-59882
Species: Hu
Applications: WB, IHC
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
AF4965
Species: Mu
Applications: WB, Simple Western, IHC
AF143
Species: Hu
Applications: WB, Simple Western, IHC
AF5016
Species: Hu
Applications: WB
NBP2-31985
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-69345
Species: Hu
Applications: WB

Publications for XYLT2 Antibody (NBP1-69345) (0)

There are no publications for XYLT2 Antibody (NBP1-69345).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XYLT2 Antibody (NBP1-69345) (0)

There are no reviews for XYLT2 Antibody (NBP1-69345). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XYLT2 Antibody (NBP1-69345) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XYLT2 Products

XYLT2 NBP1-69345

Bioinformatics Tool for XYLT2 Antibody (NBP1-69345)

Discover related pathways, diseases and genes to XYLT2 Antibody (NBP1-69345). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XYLT2 Antibody (NBP1-69345)

Discover more about diseases related to XYLT2 Antibody (NBP1-69345).
 

Pathways for XYLT2 Antibody (NBP1-69345)

View related products by pathway.

Blogs on XYLT2

There are no specific blogs for XYLT2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XYLT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XYLT2
Uniprot