Recombinant Human XRCC3 Protein

Product Discontinued

Recombinant Human XRCC3 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 31-130 of Human XRCC3 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:SGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQH

• Preparation Method: in vitro wheat germ expression system
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: XRCC3

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human XRCC3 Protein

• CMM6
• DNA repair protein XRCC3
• X-ray repair complementing defective repair in Chinese hamster cells 3
• X-ray repair cross-complementing protein 3

Background

XRCC3 - X-ray repair complementing defective repair in Chinese hamster cells 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: XRCC3