XPF Antibody

Images

 
Western Blot: XPF Antibody [NBP1-53007] - PANC1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related XPF Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53007
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

XPF Antibody Summary

Immunogen
Synthetic peptides corresponding to ERCC4 The peptide sequence was selected from the middle region of ERCC4. Peptide sequence FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST.
Clonality
Polyclonal
Host
Rabbit
Gene
ERCC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ERCC4 and was validated on Western blot.
Theoretical MW
101 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for XPF Antibody

  • DNA excision repair protein ERCC-4
  • DNA repair protein complementing XP-F cells
  • EC 3.1
  • ERCC11
  • ERCC4
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 4
  • xeroderma pigmentosum, complementation group F
  • XPF
  • XPFcomplementing defective, in Chinese hamster

Background

The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1. Defects in this gene are a cause

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP
AF3296
Species: Hu, Mu, Rt
Applications: WB
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89445
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-58116
Species: Hu
Applications: ICC/IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF6349
Species: Hu, Mu, Rt
Applications: WB
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-61070
Species: Hu
Applications: WB (-), IP
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-02280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32054
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB100-165
Species: Hu, Dr
Applications: ICC/IF (-), WB, IP

Publications for XPF Antibody (NBP1-53007) (0)

There are no publications for XPF Antibody (NBP1-53007).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPF Antibody (NBP1-53007) (0)

There are no reviews for XPF Antibody (NBP1-53007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XPF Antibody (NBP1-53007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XPF Products

Bioinformatics Tool for XPF Antibody (NBP1-53007)

Discover related pathways, diseases and genes to XPF Antibody (NBP1-53007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XPF Antibody (NBP1-53007)

Discover more about diseases related to XPF Antibody (NBP1-53007).
 

Pathways for XPF Antibody (NBP1-53007)

View related products by pathway.

PTMs for XPF Antibody (NBP1-53007)

Learn more about PTMs related to XPF Antibody (NBP1-53007).
 

Research Areas for XPF Antibody (NBP1-53007)

Find related products by research area.

Blogs on XPF.

NER Antibodies in Cancer Research
We at Novus Biologicals have over 230 products in our antibody catalog devoted to nucleotide excision repair. NER is a multi-stage sequential process involving over 30 proteins, all of which have been widely studied. Being the primary method to repair...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XPF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERCC4
Entrez
Uniprot