XPD Antibody (4G2-2A6)

Images

 
Western Blot: XPD Antibody (4G2-2A6) [H00002068-M01] - Analysis of ERCC2 expression in transfected 293T cell line by ERCC2 monoclonal antibody (M01), clone 4G2-2A6.Lane 1: ERCC2 transfected lysate(86.9 KDa).Lane 2: ...read more
Western Blot: XPD Antibody (4G2-2A6) [H00002068-M01] - ERCC2 monoclonal antibody (M01), clone 4G2-2A6 Analysis of ERCC2 expression in Hela S3 NE.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ChIP, ELISA
Clone
4G2-2A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

XPD Antibody (4G2-2A6) Summary

Immunogen
ERCC2 (AAH08346, 1 a.a. ~ 405 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGQAQHCGSSRNQKRSHP
Specificity
ERCC2 - excision repair cross-complementing rodent repair deficiency, complementation group 2 (xeroderma pigmentosum D)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ERCC2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Chromatin Immunoprecipitation
  • ELISA
Application Notes
This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA. ChIP usage reported in scientific literature (PMID: 24609361).
Publications
Read Publication using
H00002068-M01 in the following applications:

  • 1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for XPD Antibody (4G2-2A6)

  • Basic transcription factor 2 80 kDa subunit
  • BTF2 p80
  • COFS2
  • CXPD
  • DNA excision repair protein ERCC-2
  • DNA repair protein complementing XP-D cells
  • EC 3.6.1
  • EC 3.6.4.12
  • EM9
  • EM9TFIIH basal transcription factor complex 80 kDa subunit
  • ERCC2
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 2
  • MAG
  • MGC102762
  • MGC126218
  • MGC126219
  • TFIIH 80 kDa subunit
  • TFIIH basal transcription factor complex helicase subunit
  • TFIIH basal transcription factor complex helicase XPD subunit
  • TTD
  • xeroderma pigmentosum complementary group D
  • Xeroderma pigmentosum group D-complementing protein
  • XPD
  • XPDC
  • XPDTFIIH p80

Background

The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-61060
Species: Hu, Mu, V-Vi
Applications: WB, ChIP, IP
NBP1-87154
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBL1-11392
Species: Hu
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74611
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP3-04662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-165
Species: Hu, Dr, Ha
Applications: ICC/IF (-), WB, IP
AF3416
Species: Hu
Applications: WB
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-106
Species: Hu, Mu, Rt, Po, Pm, Rb
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB600-326
Species: All-NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-94035
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P

Publications for XPD Antibody (H00002068-M01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ChIP, WB.


Filter By Application
ChIP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for XPD Antibody (H00002068-M01) (0)

There are no reviews for XPD Antibody (H00002068-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar

FAQs for XPD Antibody (H00002068-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional XPD Products

Bioinformatics Tool for XPD Antibody (H00002068-M01)

Discover related pathways, diseases and genes to XPD Antibody (H00002068-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XPD Antibody (H00002068-M01)

Discover more about diseases related to XPD Antibody (H00002068-M01).
 

Pathways for XPD Antibody (H00002068-M01)

View related products by pathway.

PTMs for XPD Antibody (H00002068-M01)

Learn more about PTMs related to XPD Antibody (H00002068-M01).
 

Research Areas for XPD Antibody (H00002068-M01)

Find related products by research area.

Blogs on XPD.

Using Aflatoxin B1 Antibody for Hepatocellular Carcinoma Studies
We at Novus Biologicals are constantly updating our antibody catalog in order to provide as comprehensive a database as possible for molecular biology researchers. Not all our antibodies are derived from proteins found in mammalian or human tissue. So...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XPD Antibody (4G2-2A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol ERCC2
Entrez
OMIM