XK X-linked Kx blood group Antibody


Western Blot: XK X-linked Kx blood group Antibody [NBP1-62414] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: XK X-linked Kx blood group Antibody [NBP1-62414] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related XK X-linked Kx blood group Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

XK X-linked Kx blood group Antibody Summary

Synthetic peptides corresponding to XK(X-linked Kx blood group (McLeod syndrome)) The peptide sequence was selected from the N terminal of XK. Peptide sequence QMPKNGLSEEIEKEVGQAEGKLITHRSAFSRASVIQAFLGSAPQLTLQLY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against XK and was validated on Western blot.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for XK X-linked Kx blood group Antibody

  • Kell blood group precursor (McLeod phenotype)
  • Kell complex 37 kDa component
  • Kx antigen
  • Kx
  • membrane transport protein XK
  • X1k
  • XK, Kell blood group complex subunit (McLeod syndrome)
  • XKR1XK-related protein 1
  • X-linked Kx blood group (McLeod syndrome)
  • XRG1


This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. XK has structural characteristics of prokaryotic and eukaryotic membrane transport proteins. This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. The encoded protein has structural characteristics of prokaryotic and eukaryotic membrane transport proteins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Bv
Applications: WB, ELISA, IP
Species: Hu, Mu, Ha, Mk, Pm, Rb
Applications: IHC-P, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
Species: Hu
Applications: ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for XK X-linked Kx blood group Antibody (NBP1-62414) (0)

There are no publications for XK X-linked Kx blood group Antibody (NBP1-62414).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XK X-linked Kx blood group Antibody (NBP1-62414) (0)

There are no reviews for XK X-linked Kx blood group Antibody (NBP1-62414). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XK X-linked Kx blood group Antibody (NBP1-62414) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional XK X-linked Kx blood group Products

Bioinformatics Tool for XK X-linked Kx blood group Antibody (NBP1-62414)

Discover related pathways, diseases and genes to XK X-linked Kx blood group Antibody (NBP1-62414). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XK X-linked Kx blood group Antibody (NBP1-62414)

Discover more about diseases related to XK X-linked Kx blood group Antibody (NBP1-62414).

Pathways for XK X-linked Kx blood group Antibody (NBP1-62414)

View related products by pathway.

PTMs for XK X-linked Kx blood group Antibody (NBP1-62414)

Learn more about PTMs related to XK X-linked Kx blood group Antibody (NBP1-62414).

Research Areas for XK X-linked Kx blood group Antibody (NBP1-62414)

Find related products by research area.

Blogs on XK X-linked Kx blood group

There are no specific blogs for XK X-linked Kx blood group, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our XK X-linked Kx blood group Antibody and receive a gift card or discount.


Gene Symbol XK