XIRP1 Antibody

Images

 
Immunohistochemistry-Paraffin: XIRP1 Antibody [NBP1-85529] - Staining of human heart muscle shows intercalated disc positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

XIRP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RVSTEVAQLKEQTLARLLDIEEAVHKALSSMSSLQPEASARGHFQGPPKDHSAHKISVTVSSSARPSGSGQEVGGQTAVKNQAKVECHTEAQSQVKIRNHT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XIRP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
XIRP1 Protein (NBP1-85529PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for XIRP1 Antibody

  • cardiomyopathy associated 1
  • CMYA1
  • DKFZp779C1255
  • xin actin-binding repeat containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88066
Species: Hu
Applications: IHC, IHC-P
NBP2-33569
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87851
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-91973
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP2-00576
Species: Hu
Applications: WB, Flow, ICC/IF
H00005073-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF755
Species: Mu
Applications: WB, Block
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP1-90274
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-83411
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85529
Species: Hu
Applications: IHC, IHC-P

Publications for XIRP1 Antibody (NBP1-85529) (0)

There are no publications for XIRP1 Antibody (NBP1-85529).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XIRP1 Antibody (NBP1-85529) (0)

There are no reviews for XIRP1 Antibody (NBP1-85529). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for XIRP1 Antibody (NBP1-85529) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XIRP1 Products

XIRP1 NBP1-85529

Bioinformatics Tool for XIRP1 Antibody (NBP1-85529)

Discover related pathways, diseases and genes to XIRP1 Antibody (NBP1-85529). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XIRP1 Antibody (NBP1-85529)

Discover more about diseases related to XIRP1 Antibody (NBP1-85529).
 

Pathways for XIRP1 Antibody (NBP1-85529)

View related products by pathway.

Blogs on XIRP1

There are no specific blogs for XIRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XIRP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XIRP1