XAB1 Antibody (3E1) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related XAB1 Primary Antibodies

Order Details


    • Catalog Number
      H00011321-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

XAB1 Antibody (3E1) [PerCP] Summary

Immunogen
XAB1 (AAH07451, 9 a.a. ~ 119 a.a) partial recombinant protein with GST tag.ELQASGGPRHPVCLLVLGMAGSGKTTFVQRLTGHLHAQGTPP YVINLDPAVHEVPFPANIDIRDTVKYKEVMKQYGLGPNGGIV TSLNLFATRFDQVMKFIEKAQNMSKY
Specificity
XAB1 - XPA binding protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GPN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for XAB1 Antibody (3E1) [PerCP]

  • ATP(GTP)-binding protein
  • ATPBD1A
  • GPN-loop GTPase 1
  • GTPase
  • MBD2-interacting protein
  • MBDin
  • MBDINXPA binding protein 1
  • XAB1FLJ51176
  • XPA-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-38854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02619
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
AF3296
Species: Hu, Mu, Rt
Applications: WB
AF6349
Species: Hu, Mu, Rt
Applications: WB
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP

Publications for XAB1 Antibody (H00011321-M01PCP) (0)

There are no publications for XAB1 Antibody (H00011321-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XAB1 Antibody (H00011321-M01PCP) (0)

There are no reviews for XAB1 Antibody (H00011321-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XAB1 Antibody (H00011321-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XAB1 Products

Bioinformatics Tool for XAB1 Antibody (H00011321-M01PCP)

Discover related pathways, diseases and genes to XAB1 Antibody (H00011321-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XAB1 Antibody (H00011321-M01PCP)

Discover more about diseases related to XAB1 Antibody (H00011321-M01PCP).
 

Pathways for XAB1 Antibody (H00011321-M01PCP)

View related products by pathway.

PTMs for XAB1 Antibody (H00011321-M01PCP)

Learn more about PTMs related to XAB1 Antibody (H00011321-M01PCP).
 

Research Areas for XAB1 Antibody (H00011321-M01PCP)

Find related products by research area.

Blogs on XAB1

There are no specific blogs for XAB1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XAB1 Antibody (3E1) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol GPN1