WWP1 Antibody


Western Blot: WWP1 Antibody [NBP1-58968] - 293T cells lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/ Immunofluorescence: WWP1 Antibody [NBP1-58968] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Nuclear in pinealocytes; Primary Antibody Concentration: 1:100

Product Details

Product Discontinued
View other related WWP1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

WWP1 Antibody Summary

Synthetic peptides corresponding to WWP1(WW domain containing E3 ubiquitin protein ligase 1) The peptide sequence was selected from the N terminal of WWP1. Peptide sequence ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against WWP1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for WWP1 Antibody

  • AIP5
  • AIP5Nedd-4-like ubiquitin-protein ligase
  • atrophin-1 interacting protein 5
  • Atrophin-1-interacting protein 5
  • DKFZP434D2111
  • EC 6.3.2
  • EC 6.3.2.-
  • HSDRP1
  • NEDD4-like E3 ubiquitin-protein ligase WWP1
  • TGIF-interacting ubiquitin ligase 1
  • TIUL1
  • Tiul11
  • WW domain containing E3 ubiquitin protein ligase 1
  • WW domain-containing protein 1
  • WWP1


WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. WWP1 is a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. WWP1 belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes.WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for WWP1 Antibody (NBP1-58968) (0)

There are no publications for WWP1 Antibody (NBP1-58968).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WWP1 Antibody (NBP1-58968) (0)

There are no reviews for WWP1 Antibody (NBP1-58968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WWP1 Antibody (NBP1-58968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional WWP1 Products

Bioinformatics Tool for WWP1 Antibody (NBP1-58968)

Discover related pathways, diseases and genes to WWP1 Antibody (NBP1-58968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WWP1 Antibody (NBP1-58968)

Discover more about diseases related to WWP1 Antibody (NBP1-58968).

Pathways for WWP1 Antibody (NBP1-58968)

View related products by pathway.

PTMs for WWP1 Antibody (NBP1-58968)

Learn more about PTMs related to WWP1 Antibody (NBP1-58968).

Blogs on WWP1

There are no specific blogs for WWP1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our WWP1 Antibody and receive a gift card or discount.


Gene Symbol WWP1