WT1 Antibody (1A12)


Immunocytochemistry/ Immunofluorescence: WT1 Antibody (1A12) [H00007490-M03] - Analysis of monoclonal antibody to WT1 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF

Order Details

WT1 Antibody (1A12) Summary

WT1 (NP_000369.3, 349 a.a. - 439 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC
WT1 (1A12)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WT1 Antibody (1A12)

  • AWT1
  • GUD
  • WAGR
  • Wilms tumor 1
  • Wilms tumor protein
  • WIT-2
  • WT1
  • WT33


This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilm's tumors. Multiple transcript variants, resulting from alternative splicing at two coding exons, have been well characterized. There is also evidence for the use of non-AUG (CUG) translation initiation site upstream of, and in-frame with the first AUG, leading to additional isoforms. Authors of PMID:7926762 also provide evidence that WT1 mRNA undergoes RNA editing in human and rat, and that this process is tissue-restricted and developmentally regulated.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: ELISA, ICC/IF

Publications for WT1 Antibody (H00007490-M03) (0)

There are no publications for WT1 Antibody (H00007490-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WT1 Antibody (H00007490-M03) (0)

There are no reviews for WT1 Antibody (H00007490-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WT1 Antibody (H00007490-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional WT1 Products

Bioinformatics Tool for WT1 Antibody (H00007490-M03)

Discover related pathways, diseases and genes to WT1 Antibody (H00007490-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WT1 Antibody (H00007490-M03)

Discover more about diseases related to WT1 Antibody (H00007490-M03).

Pathways for WT1 Antibody (H00007490-M03)

View related products by pathway.

PTMs for WT1 Antibody (H00007490-M03)

Learn more about PTMs related to WT1 Antibody (H00007490-M03).

Research Areas for WT1 Antibody (H00007490-M03)

Find related products by research area.

Blogs on WT1.

Routine WT1 Antibody Screen Uncovers an Exciting New Cancer-Cleaning Enzyme
Enzyme antibodies are widely used in both apoptosis and cancer studies, as disruption of the proteins regulating apoptosis is known to lead to formation of tumor cells in certain cancers. We at Novus Biologicals are continually growing our enzyme anti...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our WT1 Antibody (1A12) and receive a gift card or discount.


Gene Symbol WT1