Home » WRN » WRN Antibodies » WRN Antibody (3C11) [PerCP]

WRN Antibody (3C11) [PerCP]

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related WRN Primary Antibodies

Order Details


    • Catalog Number
      H00007486-M09PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

WRN Antibody (3C11) [PerCP] Summary

Immunogen
WRN (NP_000544, 1322 a.a. - 1432 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPPVNSDMSKISLIRMLAPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
Specificity
WRN (3C11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
WRN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WRN Antibody (3C11) [PerCP]

  • DKFZp686C2056
  • DNA helicase, RecQ-like type 3
  • EC 3.1
  • EC 3.6.1
  • EC 3.6.4.12
  • Exonuclease WRN
  • RecQ protein-like 2
  • RecQ3
  • RECQ3RECQL3
  • RECQL2Werner syndrome ATP-dependent helicase
  • Werner syndrome
  • Werner syndrome, RecQ helicase-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Blooms Syndrome
Protein Blm Antibody
NBP1-89929
Immunocytochemistry/Immunofluorescence: Blooms Syndrome Protein Blm Antibody [NBP1-89929] - Staining of human cell line A-431 shows positivity in nucleus and cytoplasm.
Immunohistochemistry-Paraffin: Blooms Syndrome Protein Blm Antibody [NBP1-89929] - Staining of human stomach shows strong nuclear positivity in glandular cells.
(1 Review)
(3 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RECQ1 Antibody
NB100-619
Western Blot: RECQ1 Antibody [NB100-619] - Detection of Human RecQ1 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-RecQ1 antibody NB100-619 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
Immunohistochemistry: RECQ1 Antibody [NB100-619] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti- RecQ1 used at a dilution of 1:5,000 (0.2 ug/ml). Detection: DAB
Western Blot: RECQ1 Antibody [NB100-619] - Detection of human RecQ1 by Western blot using NB100-619 and human RecQ1 by immunoprecipitation. RecQ1 was immunoprecipitated poorly by NB100-618. Detection: ECL with a 30 second exposure.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, IP
RECQL4 Antibody
25470002
Immunohistochemistry: RECQL4 Antibody [25470002] - Most of the normal tissues displayed strong nuclear positivity combined with slightly weaker cytoplasmic staining. Hepatocytes were weakly stained. Malignant tissues exhibited moderate nuclear immunoreactivity which occasionally was accompanied with cytoplasmic staining. Most malignant gliomas and cases of for example malignant carcinoids, lymphomas, colo-rectal and renal cancers showed strong staining. Image and statement courtesy of the Human Protein Atlas (HPA).
ELISA: RECQL4 Antibody [25470002] - Affinity Purified
(4 Publications)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Elastin Antibody
(BA-4)
NB100-2076
Western Blot: Elastin Antibody (BA-4) [NB100-2076] - Analysis of tropoelastin using the mAb BA-4 elastin antibody (NB100-2076). A: Western blot of tropoelastin purified from bovine ligamentum nuchae tissue minces. B: Autoradiogram of a gradient SDS-polyacrylamide gel showing [3H] leucine-labeled tropoelasti.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Formalin fixed paraffin embedded human kidney stained with Elastin antibody.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Elastin surrounding blood vessel in pig testis. Image from verified customer review.
(2 Reviews)
(2 Publications)
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - p19ARF antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - IHC analysis of formalin fixed paraffin-embedded (FFPE) mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
PCNA Antibody
(PC10)
NB500-106
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Analysis of PCNA in mouse cornea. Image courtesy of product review by Bo-Yie Chen.
(4 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
RECQL5 Antibody
NBP1-83438
Western Blot: RECQL5 Antibody [NBP1-83438] - Analysis in human cell line A-549.
Immunocytochemistry/Immunofluorescence: RECQL5 Antibody [NBP1-83438] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: RECQL5 Antibody [NBP1-83438] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
FEN-1 Antibody
(4E7)
NB100-150
Western Blot: FEN-1 Antibody (4E7) [NB100-150] - Whole cell extract (30 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with FEN1 antibody diluted at 1:500.
Immunocytochemistry/Immunofluorescence: FEN-1 Antibody (4E7) [NB100-150] - Analysis of paraformaldehyde-fixed MCF7, using antibody at 1:200 dilution.
(17 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Ku80/XRCC5 Antibody
NBP1-56408
Western Blot: Ku80/XRCC5 Antibody [NBP1-56408] - analysis of HeLa cell lysate (30ug) using anti-Ku80 antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Ku80/XRCC5 Antibody [NBP1-56408] - Human lung adenocarcinoma cell line A549.
Immunohistochemistry-Paraffin: Ku80/XRCC5 Antibody [NBP1-56408] - Human Pancrease (Epithelial cells of acinus indicated with arrows), 4-8ug/ml.
(1 Review)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TRF-2 Antibody
(4A794.15)
NB100-56506
Simple Western: TRF-2 Antibody (4A794.15) [NB100-56506] - Simple Western lane view shows a specific band for TRF2 in 1.0 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Western Blot: TRF-2 Antibody (4A794.15) [NB100-56506] - Analysis in human Jurkat cell lysate at 2 ug/ml. Goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: TRF-2 Antibody (4A794.15) [NB100-56506] - Staining of TRF2-bound telomeres in human HeLa cells (Courtesy of Fotiadou, et al, 2004).
(1 Review)
(92 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
ATM Antibody
NB100-104
Western Blot: ATM Antibody [NB100-104] - Detection of ATM in HeLa nuclear extract using NB100-104. (30 sec. exposure)
Immunocytochemistry/Immunofluorescence: ATM Antibody [NB100-104] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.05% Triton-X100. Then cells were incubated with anti-ATM (NB100-104) at a 1:100 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: ATM Antibody [NB100-104] - Staining of human tonsil, germinal center and mantle zone.
(2 Reviews)
(79 Publications)
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
PARP Antibody
(194C1439) - (Azide F ...
NBP2-27335
Western Blot: PARP Antibody (194C1439) - (Azide Free), Cleaved [NBP2-27335] - PARP Antibody (194C1439) [Azide Free] [NBP2-27335] - Analysis of cleaved PARP in staurosporine-treated Jurkat cells at various time points, using this antibody. The band corresponding to cleaved PARP is only seen in the treated samples. anti-mouse Ig HRP conjugate was used in this test.
Western Blot: PARP Antibody (194C1439) [Azide Free] [NBP2-27335] - Western analysis using 293T lysates expressing PARP. Image from verified customer review.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready
Mre11 Antibody
NB100-142
Western Blot: Mre11 Antibody [NB100-142] - Analysis of Mre11 on 50 ug of HeLa and MEF lysates, using NB100-142.
Immunocytochemistry/Immunofluorescence: Mre11 Antibody [NB100-142] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-Mre11 [NB100-142] at a 1:500 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: Mre11 Antibody [NB100-142] - Staining of MRE11 in a human epidermis cross section.
(4 Reviews)
(152 Publications)
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Rad51 Antibody
(14B4)
NB100-148
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Whole cell extract (30 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The signal was developed with Trident ECL plus-Enhanced.
Immunocytochemistry/Immunofluorescence: Rad51 Antibody (14B4) [NB100-148] - staning of RAD51 nuclear foci in U2OS cells using RAD51 14B4 antibody. Cells were pre-extracted with CSK buffer before fixation with 4% PFA. RAD51 14B4 was used at 1:1000 dultion. DAPI was used to counterstain the nucleus. Scale bar, 10 mciro-meter.
Immunohistochemistry-Paraffin: Rad51 Antibody (14B4) [NB100-148] - Detects RAD51 in nucleus on BT483 xenograft by immunohistochemical analysis. Sample: Paraffin-embedded BT483 xenograft. RAD51 antibody 14B4 at a dilution of 1:200.
(3 Reviews)
(37 Publications)
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
MLH1 Antibody
(164C819)
NB100-56552
Western Blot: MLH1 Antibody (164C819) [NB100-56552] - Analysis of MLH1 in Daudi cell lysate using this antibody at 2 ug/ml.
Species: Hu
Applications: WB
BRCA1 Antibody
(RAY)
NB100-598
Western Blot: BRCA1 Antibody (RAY) [NB100-598] - Analysis of BRCA1 on MCF7 lysate.
Immunocytochemistry/Immunofluorescence: BRCA1 Antibody (RAY) [NB100-598] - BRCA (RAY) antibody was tested in MCF-7 cells with FITC (green). Nuclei and alpha-tubulin were counterstained with Dapi (blue) and Dylight 550 (red).
Flow Cytometry: BRCA1 Antibody (RAY) [NB100-598] - Intracellular flow cytometric staining of 1 x 10^6 MCF-7 cells using BRCA1 antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(4 Publications)
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
gamma H2AX [p
Ser139] Antibody
NB100-384
Immunocytochemistry/Immunofluorescence: gamma H2AX [p Ser139] Antibody [NB100-384] - Samples: Neocarzinostatin treated asynchronous HeLa cells (left) and untreated asynchronous HeLa cells (right). Antibody: Affinity purified rabbit anti-gamma-H2AX used at a dilution of 1:5,000 (0.2ug/ml). Detection: Red fluorescent Anti-rabbit IgG-DyLight 594 used at a dilution of 1:100.
Flow Cytometry: gamma H2AX [p Ser139] Antibody [NB100-384] - Analysis of gamma-H2AX in Etoposide Treated Jurkat Cells. Cells were treated for 3 hrs in 5ug/ml etoposide, fixed in 1.5% PFA, and permeabilized in 90% Methanol. 1 million cells were stained with 0.5 ug anti-KLH or anti-H2AX NB100-384 and secondary FITC-conjugated goat anti-rabbit (in a 150ul reaction). Black- etosposide treated, anti-KLH; Red- untreated, anti-gamma H2AX; Blue- etoposide treated, anti-gamma H2AX.
Western Blot: gamma H2AX [p Ser139] Antibody [NB100-384] - Samples: Nuclear extract from HeLa cells treated with 100 uM etoposide for 4 hours (+) or mock treated (-). Antibody: Affinity purified rabbit anti-gamma-H2AX antibody used at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
(1 Review)
(67 Publications)
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
DNA-PKcs Antibody
(3H6)
NBP2-22128
Western Blot: DNA PKcs Antibody (3H6) [NBP2-22128] - Western blot image of DNA PKcs. HeLa (lane A), MCF7 (lane B) and HEK293 (lane C) whole cell protein was separated by SDS-PAGE on 6% gel, transferred to PVDF and probed with NBP2-22128. A single band of DNA PKcs reactivity at approximately 460 kDa was detected in all lysates.
Immunocytochemistry/Immunofluorescence: DNA PKcs Antibody (3H6) [NBP2-22128] - Immunofluorescence analysis of Hela cells using DNA PKcs mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: DNA PKcs Antibody (3H6) [NBP2-22128] - Immunohistochemical analysis of paraffin-embedded lung cancer (left) and brain tissues (right) using DNA PKcs mouse mAb with DAB staining.
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
WRN Antibody
(3C11) [PerCP]
H00007486-M09PCP
WRN Antibody (3C11) [PerCP]
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for WRN Antibody (H00007486-M09PCP) (0)

There are no publications for WRN Antibody (H00007486-M09PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WRN Antibody (H00007486-M09PCP) (0)

There are no reviews for WRN Antibody (H00007486-M09PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WRN Antibody (H00007486-M09PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WRN Products

Bioinformatics Tool for WRN Antibody (H00007486-M09PCP)

Discover related pathways, diseases and genes to WRN Antibody (H00007486-M09PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WRN Antibody (H00007486-M09PCP)

Discover more about diseases related to WRN Antibody (H00007486-M09PCP).
 

Pathways for WRN Antibody (H00007486-M09PCP)

View related products by pathway.

PTMs for WRN Antibody (H00007486-M09PCP)

Learn more about PTMs related to WRN Antibody (H00007486-M09PCP).
 

Research Areas for WRN Antibody (H00007486-M09PCP)

Find related products by research area.

Blogs on WRN.

Check out the latest blog posts on WRN.
Not as Pluripotent as You Used to Be: Embryonic Stem Cell Markers and the Aging Process
We at Novus Biologicals recently extended our antibody catalog to include several embryonic stem cells (ESC) antibodies validated for use in FACS (fluorescent activated cell sorting) assays. Among them was Oct4, which recently became the focus of an i...  Read full blog post.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WRN Antibody (3C11) [PerCP] and receive a gift card or discount.


Bioinformatics

Gene Symbol WRN