WRN Antibody (3C11) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related WRN Primary Antibodies

Order Details


    • Catalog Number
      H00007486-M09G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

WRN Antibody (3C11) [DyLight 488] Summary

Immunogen
WRN (NP_000544, 1322 a.a. - 1432 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPPVNSDMSKISLIRMLAPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
Specificity
WRN (3C11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
WRN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WRN Antibody (3C11) [DyLight 488]

  • DKFZp686C2056
  • DNA helicase, RecQ-like type 3
  • EC 3.1
  • EC 3.6.1
  • EC 3.6.4.12
  • Exonuclease WRN
  • RecQ protein-like 2
  • RecQ3
  • RECQ3RECQL3
  • RECQL2Werner syndrome ATP-dependent helicase
  • Werner syndrome
  • Werner syndrome, RecQ helicase-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-619
Species: Hu
Applications: WB, IHC, IHC-P, IP
25470002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-83438
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-56552
Species: Hu
Applications: WB
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
H00007486-M09G
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for WRN Antibody (H00007486-M09G) (0)

There are no publications for WRN Antibody (H00007486-M09G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WRN Antibody (H00007486-M09G) (0)

There are no reviews for WRN Antibody (H00007486-M09G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WRN Antibody (H00007486-M09G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WRN Products

WRN H00007486-M09G

Bioinformatics Tool for WRN Antibody (H00007486-M09G)

Discover related pathways, diseases and genes to WRN Antibody (H00007486-M09G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WRN Antibody (H00007486-M09G)

Discover more about diseases related to WRN Antibody (H00007486-M09G).
 

Pathways for WRN Antibody (H00007486-M09G)

View related products by pathway.

PTMs for WRN Antibody (H00007486-M09G)

Learn more about PTMs related to WRN Antibody (H00007486-M09G).
 

Research Areas for WRN Antibody (H00007486-M09G)

Find related products by research area.

Blogs on WRN.

Not as Pluripotent as You Used to Be: Embryonic Stem Cell Markers and the Aging Process
We at Novus Biologicals recently extended our antibody catalog to include several embryonic stem cells (ESC) antibodies validated for use in FACS (fluorescent activated cell sorting) assays. Among them was Oct4, which recently became the focus of an i...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WRN Antibody (3C11) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol WRN