Wnt16 Antibody

Images

 
Western Blot: Wnt16 Antibody [NBP1-52878] - Fetal Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Wnt16 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52878
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Wnt16 Antibody Summary

Immunogen
Synthetic peptides corresponding to WNT16(wingless-type MMTV integration site family, member 16) The peptide sequence was selected from the middle region of WNT16. Peptide sequence KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN.
Clonality
Polyclonal
Host
Rabbit
Gene
WNT16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against WNT16 and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Wnt16 Antibody

  • protein Wnt-16
  • wingless-type MMTV integration site family, member 16

Background

WNT proteins are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT16 contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF475
Species: Mu
Applications: WB, IHC
AF3157
Species: Hu
Applications: WB, IHC
3008-WN/CF
Species: Hu
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15163
Species: Hu, Mu
Applications: WB, IHC, IHC-P
3900-WN/CF
Species: Mu
645-WN/CF
Species: Hu, Mu
3669-WN/CF
Species: Mu
NBP2-46367
Species: Hu
Applications: WB, IHC
AF4109
Species: Hu
Applications: WB, IHC
NBP1-76916
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
7196-WN/CF
Species: Hu
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF1384
Species: Hu
Applications: WB, IHC, ICC
NBP1-52878
Species: Hu
Applications: WB

Publications for Wnt16 Antibody (NBP1-52878) (0)

There are no publications for Wnt16 Antibody (NBP1-52878).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wnt16 Antibody (NBP1-52878) (0)

There are no reviews for Wnt16 Antibody (NBP1-52878). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Wnt16 Antibody (NBP1-52878) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Wnt16 Products

Bioinformatics Tool for Wnt16 Antibody (NBP1-52878)

Discover related pathways, diseases and genes to Wnt16 Antibody (NBP1-52878). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt16 Antibody (NBP1-52878)

Discover more about diseases related to Wnt16 Antibody (NBP1-52878).
 

Pathways for Wnt16 Antibody (NBP1-52878)

View related products by pathway.

PTMs for Wnt16 Antibody (NBP1-52878)

Learn more about PTMs related to Wnt16 Antibody (NBP1-52878).
 

Research Areas for Wnt16 Antibody (NBP1-52878)

Find related products by research area.

Blogs on Wnt16

There are no specific blogs for Wnt16, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT16