Wnt-4 Antibody

Images

 
Western Blot: WNT4 Antibody [NBP1-69648] - This Anti-WNT4 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Product Discontinued
View other related Wnt-4 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69648
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Wnt-4 Antibody Summary

Immunogen
Synthetic peptides corresponding to WNT4(wingless-type MMTV integration site family, member 4) The peptide sequence was selected from the middle region of WNT4. Peptide sequence HGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNE.
Clonality
Polyclonal
Host
Rabbit
Gene
WNT4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against WNT4 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Wnt-4 Antibody

  • protein Wnt-4
  • SERKAL
  • wingless-type MMTV integration site family, member 4
  • Wnt4
  • Wnt-4

Background

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
645-WN/CF
Species: Hu, Mu
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF3075
Species: Hu
Applications: WB, ICC
AF1620
Species: Mu
Applications: WB, IHC
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
3008-WN/CF
Species: Hu
AF1620
Species: Mu
Applications: WB, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-46367
Species: Hu
Applications: WB, IHC
NBP2-15163
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
645-WN/CF
Species: Hu, Mu

Publications for Wnt-4 Antibody (NBP1-69648) (0)

There are no publications for Wnt-4 Antibody (NBP1-69648).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wnt-4 Antibody (NBP1-69648) (0)

There are no reviews for Wnt-4 Antibody (NBP1-69648). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Wnt-4 Antibody (NBP1-69648) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Wnt-4 Products

Bioinformatics Tool for Wnt-4 Antibody (NBP1-69648)

Discover related pathways, diseases and genes to Wnt-4 Antibody (NBP1-69648). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-4 Antibody (NBP1-69648)

Discover more about diseases related to Wnt-4 Antibody (NBP1-69648).
 

Pathways for Wnt-4 Antibody (NBP1-69648)

View related products by pathway.

PTMs for Wnt-4 Antibody (NBP1-69648)

Learn more about PTMs related to Wnt-4 Antibody (NBP1-69648).
 

Research Areas for Wnt-4 Antibody (NBP1-69648)

Find related products by research area.

Blogs on Wnt-4

There are no specific blogs for Wnt-4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt-4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT4
Entrez
Uniprot