Wnt-1 Antibody

Images

 
Western Blot: Wnt-1 Antibody [NBP1-69271] - Sample Type: 1. Molecular Weight 2. Control (20ug) 3. shRNA1-WNT1 H9 hES cells (20ug) 4. shRNA2-WNT1 H9 hES cells (20ug) Primary Dilution: 1:1000 Secondary Antibody: ...read more
Western Blot: Wnt-1 Antibody [NBP1-69271] - This Anti-WNT1 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.
Western Blot: Wnt-1 Antibody [NBP1-69271] - Sample Tissue: Human HepG2 Antibody Dilution: 1.0 ug/ml
Western Blot: Wnt-1 Antibody [NBP1-69271] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Muscle

Product Details

Summary
Product Discontinued
View other related Wnt-1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69271
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Wnt-1 Antibody Summary

Immunogen
Synthetic peptides corresponding to WNT1(wingless-type MMTV integration site family, member 1) The peptide sequence was selected from the middle region of WNT1. Peptide sequence FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV.
Clonality
Polyclonal
Host
Rabbit
Gene
WNT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against WNT1 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Wnt-1 Antibody

  • Int-1
  • INT1Proto-oncogene Int-1 homolog
  • proto-oncogene Wnt-1
  • wingless-type MMTV integration site family, member 1 (oncogene INT1)
  • wingless-type MMTV integration site family, member 1
  • Wnt1
  • Wnt-1

Background

WNT1 is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT1 is very conserved in evolution, and it is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. WNT1 was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. WNT1 is clustered with another family member, WNT10B, in the chromosome 12q13 region.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is very conserved in evolution, and the protein encoded by this gene is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. This gene is clustered with another family member, WNT10B, in the chromosome 12q13 region. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF1620
Species: Mu
Applications: WB, IHC
NBP1-91612
Species: Mu
Applications: WB
423-F8/CF
Species: Hu, Mu
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-57016
Species: Hu
Applications: WB
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-46367
Species: Hu
Applications: WB, IHC
AF3287
Species: Hu, Mu, Rt
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-69271
Species: Hu
Applications: WB

Publications for Wnt-1 Antibody (NBP1-69271) (0)

There are no publications for Wnt-1 Antibody (NBP1-69271).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wnt-1 Antibody (NBP1-69271) (0)

There are no reviews for Wnt-1 Antibody (NBP1-69271). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Wnt-1 Antibody (NBP1-69271) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Wnt-1 Products

Bioinformatics Tool for Wnt-1 Antibody (NBP1-69271)

Discover related pathways, diseases and genes to Wnt-1 Antibody (NBP1-69271). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-1 Antibody (NBP1-69271)

Discover more about diseases related to Wnt-1 Antibody (NBP1-69271).
 

Pathways for Wnt-1 Antibody (NBP1-69271)

View related products by pathway.

PTMs for Wnt-1 Antibody (NBP1-69271)

Learn more about PTMs related to Wnt-1 Antibody (NBP1-69271).
 

Research Areas for Wnt-1 Antibody (NBP1-69271)

Find related products by research area.

Blogs on Wnt-1

There are no specific blogs for Wnt-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT1
Entrez
Uniprot