Recombinant Human WNK2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human WNK2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 2118-2217 of Human WNK2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KGTFTDDLHKLVDEWTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPRLPPAPGPLSTTVIPGAAPTLSVPTPDPESEKPD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
WNK2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WNK2 Protein

  • EC 2.7.11
  • EC 2.7.11.1
  • PRK
  • PRKWNK2
  • Protein kinase with no lysine 2
  • SDCCAG43
  • serine/threonine-protein kinase WNK2
  • Serologically defined colon cancer antigen 43lysine deficient 2
  • WNK lysine deficient protein kinase 2

Background

WNK2 - WNK lysine deficient protein kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56363
Species: Hu, Mu
Applications: WB
AF4559
Species: Hu
Applications: WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46228
Species: Hu
Applications: WB, IHC

Publications for WNK2 Partial Recombinant Protein (H00065268-Q01) (0)

There are no publications for WNK2 Partial Recombinant Protein (H00065268-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WNK2 Partial Recombinant Protein (H00065268-Q01) (0)

There are no reviews for WNK2 Partial Recombinant Protein (H00065268-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WNK2 Partial Recombinant Protein (H00065268-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WNK2 Products

Bioinformatics Tool for WNK2 Partial Recombinant Protein (H00065268-Q01)

Discover related pathways, diseases and genes to WNK2 Partial Recombinant Protein (H00065268-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WNK2 Partial Recombinant Protein (H00065268-Q01)

Discover more about diseases related to WNK2 Partial Recombinant Protein (H00065268-Q01).
 

Pathways for WNK2 Partial Recombinant Protein (H00065268-Q01)

View related products by pathway.

PTMs for WNK2 Partial Recombinant Protein (H00065268-Q01)

Learn more about PTMs related to WNK2 Partial Recombinant Protein (H00065268-Q01).
 

Research Areas for WNK2 Partial Recombinant Protein (H00065268-Q01)

Find related products by research area.

Blogs on WNK2

There are no specific blogs for WNK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WNK2 Antibody
25910002-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WNK2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WNK2