WIPI1 Partial Protein

Images

 
SDS-Page: WIPI1 Partial Protein [H00055062-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

WIPI1 Partial Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 348-445 of Human WIPI1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Protein
Gene
WIPI1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WIPI1 Partial Protein

  • Atg18 protein homolog
  • Atg18
  • ATG18A
  • FLJ10055
  • WD repeat domain phosphoinositide-interacting protein 1
  • WD repeat domain, phosphoinositide interacting 1
  • WD40 repeat protein interacting with phosphoinositides of 49 kDa
  • WD40 repeat protein Interacting with phosphoInositides of 49kDa
  • WIPI 49 kDa
  • WIPI-1 alpha
  • WIPI-1
  • WIPI49ATG18

Background

WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI1, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids (Proikas-Cezanne et al., 2004 [PubMed 15602573]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-88879
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
AF853
Species: Mu
Applications: WB, IHC
H00200576-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24594
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NB100-56398
Species: Hu
Applications: WB, ICC/IF
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-80838
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
26160002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WIPI1 Partial Recombinant Protein (H00055062-Q01) (0)

There are no publications for WIPI1 Partial Recombinant Protein (H00055062-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WIPI1 Partial Recombinant Protein (H00055062-Q01) (0)

There are no reviews for WIPI1 Partial Recombinant Protein (H00055062-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WIPI1 Partial Recombinant Protein (H00055062-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WIPI1 Products

Bioinformatics Tool for WIPI1 Partial Recombinant Protein (H00055062-Q01)

Discover related pathways, diseases and genes to WIPI1 Partial Recombinant Protein (H00055062-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WIPI1 Partial Recombinant Protein (H00055062-Q01)

Discover more about diseases related to WIPI1 Partial Recombinant Protein (H00055062-Q01).
 

Pathways for WIPI1 Partial Recombinant Protein (H00055062-Q01)

View related products by pathway.

PTMs for WIPI1 Partial Recombinant Protein (H00055062-Q01)

Learn more about PTMs related to WIPI1 Partial Recombinant Protein (H00055062-Q01).

Blogs on WIPI1.

WIPI1 - An essential regulator of early autophagosome assembly
WD repeat domain phosphoinositide-interacting protein 1 (WIPI) is involved in the lysosomal degradation of cytoplasmic components during starvation-induced autophagy. WIPI1 is a seven bladed beta-propeller protein that provides a scaffold for the ...  Read full blog post.

Customers Who Bought This Also Bought

LC3A Antibody
NB100-2331
WIPI1 Antibody
NBP1-88878
ATG5 Antibody
NB110-53818

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WIPI1 Partial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WIPI1