Recombinant Human WFDC5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human WFDC5 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 123 of Human WFDC5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCYRACFRQCVPRVSVKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
WFDC5
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WFDC5 Protein

  • dJ211D12.5
  • PRG5protease inhibitor WAP1
  • Putative protease inhibitor WAP1
  • WAP four-disulfide core domain 5
  • WAP four-disulfide core domain protein 5
  • WAP1p53-responsive gene 5 protein

Background

WFDC5( AAH39173, 1 a.a. - 124 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-51521
Species: Hu
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1747
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46360
Species: Hu
Applications: WB, IHC
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00007290-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-84270
Species: Hu
Applications: IHC, IHC-P
NBP1-87570
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-170
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P

Publications for WFDC5 Recombinant Protein (H00149708-P01) (0)

There are no publications for WFDC5 Recombinant Protein (H00149708-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WFDC5 Recombinant Protein (H00149708-P01) (0)

There are no reviews for WFDC5 Recombinant Protein (H00149708-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WFDC5 Recombinant Protein (H00149708-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WFDC5 Products

Bioinformatics Tool for WFDC5 Recombinant Protein (H00149708-P01)

Discover related pathways, diseases and genes to WFDC5 Recombinant Protein (H00149708-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WFDC5 Recombinant Protein (H00149708-P01)

Discover more about diseases related to WFDC5 Recombinant Protein (H00149708-P01).
 

Pathways for WFDC5 Recombinant Protein (H00149708-P01)

View related products by pathway.

Blogs on WFDC5

There are no specific blogs for WFDC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WFDC5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WFDC5