WDR92 Antibody

Images

 
Western Blot: WDR92 Antibody [NBP1-74159] - Mouse Small Intestine Lysate 1.0 ug/ml, gel concentration 12%

Product Details

Summary
Product Discontinued
View other related WDR92 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74159
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

WDR92 Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Wdr92. Immunizing peptide sequence NMEPAQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMSLRW.
Clonality
Polyclonal
Host
Rabbit
Gene
WDR92
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Wdr92 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for WDR92 Antibody

  • FLJ31741
  • LOC116143
  • monad
  • WD repeat domain 92
  • WD repeat-containing protein 92
  • WD repeat-containing protein Monad

Background

Wdr92 seems to act as a modulator of apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89849
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-40354
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NBP1-88505
Species: Hu
Applications: IHC, IHC-P
NBP1-85569
Species: Hu
Applications: WB, IHC, IHC-P
H00064396-P01
Species: Hu
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-38640
Species: Hu
Applications: IHC, IHC-P
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-74159
Species: Mu
Applications: WB

Publications for WDR92 Antibody (NBP1-74159) (0)

There are no publications for WDR92 Antibody (NBP1-74159).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR92 Antibody (NBP1-74159) (0)

There are no reviews for WDR92 Antibody (NBP1-74159). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR92 Antibody (NBP1-74159) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR92 Products

Bioinformatics Tool for WDR92 Antibody (NBP1-74159)

Discover related pathways, diseases and genes to WDR92 Antibody (NBP1-74159). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on WDR92

There are no specific blogs for WDR92, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR92 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR92
Uniprot