WDFY2 Antibody

Images

 
Western Blot: WDFY2 Antibody [NBP2-84331] - Host: Rabbit. Target Name: WDFY2. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDFY2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDFY2. Peptide sequence: RQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
WDFY2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDFY2 Antibody

  • propeller-FYVE protein
  • RP11-147H23.1
  • WD repeat and FYVE domain containing 2
  • WD repeat and FYVE domain-containing protein 2
  • WD40 and FYVE domain containing 2
  • WD40- and FYVE domain-containing protein 2
  • WDF2
  • ZFYVE22PROF
  • Zinc finger FYVE domain-containing protein 22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-36568
Species: Hu, Mu, V-Vi
Applications: WB, IHC, IHC-P, Flow-IC
NBP2-84177
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
NBP2-92796
Species: Hu, Mu
Applications: WB, IHC
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB300-595
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB100-360
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP2-31376
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88809
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13253
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-90364
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00051776-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for WDFY2 Antibody (NBP2-84331) (0)

There are no publications for WDFY2 Antibody (NBP2-84331).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDFY2 Antibody (NBP2-84331) (0)

There are no reviews for WDFY2 Antibody (NBP2-84331). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDFY2 Antibody (NBP2-84331) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WDFY2 Products

Bioinformatics Tool for WDFY2 Antibody (NBP2-84331)

Discover related pathways, diseases and genes to WDFY2 Antibody (NBP2-84331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDFY2 Antibody (NBP2-84331)

Discover more about diseases related to WDFY2 Antibody (NBP2-84331).
 

Pathways for WDFY2 Antibody (NBP2-84331)

View related products by pathway.

PTMs for WDFY2 Antibody (NBP2-84331)

Learn more about PTMs related to WDFY2 Antibody (NBP2-84331).

Blogs on WDFY2

There are no specific blogs for WDFY2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDFY2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDFY2