![Immunohistochemistry-Paraffin: WBP2NL Antibody [NBP2-33531] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/WBP2NL-Antibody-Immunohistochemistry-Paraffin-NBP2-33531-img0003.jpg "Immunohistochemistry-Paraffin: WBP2NL Antibody [NBP2-33531] - Staining of human testis shows high expression.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGDAIEFAQLMVKAA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WBP2NL |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: WBP2NL Antibody [NBP2-33531] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/WBP2NL-Antibody-Immunohistochemistry-Paraffin-NBP2-33531-img0002.jpg "Immunohistochemistry-Paraffin: WBP2NL Antibody [NBP2-33531] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: WBP2NL Antibody [NBP2-33531] - Staining in human testis and skeletal muscle tissues using anti-WBP2NL antibody. Corresponding WBP2NL RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/WBP2NL-Antibody-Immunohistochemistry-Paraffin-NBP2-33531-img0004.jpg "Immunohistochemistry-Paraffin: WBP2NL Antibody [NBP2-33531] - Staining in human testis and skeletal muscle tissues using anti-WBP2NL antibody. Corresponding WBP2NL RNA-seq data are presented for the same tissues.")
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Flow Cytometry CD155/PVR Antibody (300907) [Unconjugated]](https://images.novusbio.com/images2/CD155_MAB25301_Flow_Cytometry_20610.jpg)
![Flow Cytometry CD155/PVR Antibody (300907) [Unconjugated]](https://images.novusbio.com/images2/CD155_MAB25301_Flow_Cytometry_20611.jpg)
![Immunocytochemistry CD155/PVR Antibody (300907) [Unconjugated]](https://images.novusbio.com/images2/CD155_MAB25301_Immunocytochemistry__Immunofluorescence_17423.jpg)
![Immunocytochemistry Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Immunocytochemistry_6472.jpg)
![Simple Western Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Simple_Western_18959.jpg)
![Western Blot Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Western_Blot_18960.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")