VRK2 Antibody (3B10) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related VRK2 Primary Antibodies

Order Details


    • Catalog Number
      H00007444-M01V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

VRK2 Antibody (3B10) [DyLight 405] Summary

Immunogen
VRK2 (AAH27854 260 a.a. - 360 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLI
Specificity
VRK2 - vaccinia related kinase 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VRK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VRK2 Antibody (3B10) [DyLight 405]

  • EC 2.7.11.1
  • serine/threonine-protein kinase VRK2
  • vaccinia related kinase 2
  • vaccinia virus B1R-related kinase 2
  • Vaccinia-related kinase 2
  • vaccinia-related kinase-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85822
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-16277
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58572
Species: Hu
Applications: ICC/IF, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-59826
Species: Hu
Applications: WB, Simple Western, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-82863
Species: Hu
Applications: IHC, IHC-P
AF4366
Species: Hu, Mu, Rt
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for VRK2 Antibody (H00007444-M01V) (0)

There are no publications for VRK2 Antibody (H00007444-M01V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VRK2 Antibody (H00007444-M01V) (0)

There are no reviews for VRK2 Antibody (H00007444-M01V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VRK2 Antibody (H00007444-M01V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VRK2 Antibody (3B10) [DyLight 405] Products

Related Products by Gene

Bioinformatics Tool for VRK2 Antibody (H00007444-M01V)

Discover related pathways, diseases and genes to VRK2 Antibody (H00007444-M01V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VRK2 Antibody (H00007444-M01V)

Discover more about diseases related to VRK2 Antibody (H00007444-M01V).
 

Pathways for VRK2 Antibody (H00007444-M01V)

View related products by pathway.

PTMs for VRK2 Antibody (H00007444-M01V)

Learn more about PTMs related to VRK2 Antibody (H00007444-M01V).
 

Research Areas for VRK2 Antibody (H00007444-M01V)

Find related products by research area.

Blogs on VRK2

There are no specific blogs for VRK2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VRK2 Antibody (3B10) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol VRK2