VRK1 Antibody (4F9) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related VRK1 Primary Antibodies

Order Details


    • Catalog Number
      H00007443-M02G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

VRK1 Antibody (4F9) [DyLight 488] Summary

Immunogen
VRK1 (NP_003375, 287 a.a. - 396 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK
Specificity
VRK1 - vaccinia related kinase 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VRK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VRK1 Antibody (4F9) [DyLight 488]

  • EC 2.7.11.1
  • MGC117401
  • MGC138280
  • MGC142070
  • PCH1
  • serine/threonine-protein kinase VRK1
  • vaccinia related kinase 1
  • vaccinia virus B1R-related kinase 1
  • Vaccinia-related kinase 1
  • VRK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00007444-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90335
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30377
Species: Hu
Applications: WB, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00007443-M02G
Species: Hu
Applications: WB, ELISA, ICC/IF, IP

Publications for VRK1 Antibody (H00007443-M02G) (0)

There are no publications for VRK1 Antibody (H00007443-M02G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VRK1 Antibody (H00007443-M02G) (0)

There are no reviews for VRK1 Antibody (H00007443-M02G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VRK1 Antibody (H00007443-M02G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VRK1 Products

Bioinformatics Tool for VRK1 Antibody (H00007443-M02G)

Discover related pathways, diseases and genes to VRK1 Antibody (H00007443-M02G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VRK1 Antibody (H00007443-M02G)

Discover more about diseases related to VRK1 Antibody (H00007443-M02G).
 

Pathways for VRK1 Antibody (H00007443-M02G)

View related products by pathway.

PTMs for VRK1 Antibody (H00007443-M02G)

Learn more about PTMs related to VRK1 Antibody (H00007443-M02G).
 

Research Areas for VRK1 Antibody (H00007443-M02G)

Find related products by research area.

Blogs on VRK1

There are no specific blogs for VRK1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VRK1 Antibody (4F9) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol VRK1
Entrez