VPS45 Antibody


Western Blot: VPS45 Antibody [NBP1-74158]

Product Details

Product Discontinued
View other related VPS45 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

VPS45 Antibody Summary

Synthetic peptides corresponding to the C terminal of Vps45. Immunizing peptide sequence VEYGGKRVRGSDLFSPKDAVAITKQFLKGLKGVENVYTQHQPFLHETLDH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Vps45 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for VPS45 Antibody

  • H1
  • H1VPS45
  • hlVps45
  • h-vps45
  • leucocyte vacuolar protein sorting 45
  • vacuolar protein sorting 45 homolog (S. cerevisiae)
  • vacuolar protein sorting 45A (yeast homolog)
  • vacuolar protein sorting 45A (yeast)
  • vacuolar protein sorting 45A
  • vacuolar protein sorting-associated protein 45
  • VPS45A
  • VPS45AVPS54A
  • VPS45B
  • VSP45
  • VSP45A


Vps45 may play a role in vesicle-mediated protein trafficking from the Golgi stack through the trans-Golgi network.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Ce, Pl
Applications: WB, ELISA, IHC
Species: Mu
Applications: WB

Publications for VPS45 Antibody (NBP1-74158) (0)

There are no publications for VPS45 Antibody (NBP1-74158).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS45 Antibody (NBP1-74158) (0)

There are no reviews for VPS45 Antibody (NBP1-74158). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS45 Antibody (NBP1-74158) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional VPS45 Products

Bioinformatics Tool for VPS45 Antibody (NBP1-74158)

Discover related pathways, diseases and genes to VPS45 Antibody (NBP1-74158). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS45 Antibody (NBP1-74158)

Discover more about diseases related to VPS45 Antibody (NBP1-74158).

Pathways for VPS45 Antibody (NBP1-74158)

View related products by pathway.

PTMs for VPS45 Antibody (NBP1-74158)

Learn more about PTMs related to VPS45 Antibody (NBP1-74158).

Blogs on VPS45

There are no specific blogs for VPS45, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VPS45 Antibody and receive a gift card or discount.


Gene Symbol VPS45