VPS37A Antibody


Western Blot: VPS37A Antibody [NBP1-55089] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Product Discontinued
View other related VPS37A Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

VPS37A Antibody Summary

Synthetic peptides corresponding to VPS37A(vacuolar protein sorting 37 homolog A (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS37A. Peptide sequence SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against VPS37A and was validated on Western blot.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for VPS37A Antibody

  • ESCRT-I complex subunit VPS37A
  • FLJ32642
  • HCRP1FLJ42616
  • hepatocellular carcinoma related protein 1
  • Hepatocellular carcinoma-related protein 1
  • hVps37A
  • polyglutamine binding protein 2
  • PQBP2
  • vacuolar protein sorting 37 homolog A (S. cerevisiae)
  • vacuolar protein sorting 37A (yeast)
  • vacuolar protein sorting 37A
  • vacuolar protein sorting-associated protein 37A


VPS37A is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. VPS37A may be involved in cell growth and differentiation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for VPS37A Antibody (NBP1-55089) (0)

There are no publications for VPS37A Antibody (NBP1-55089).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS37A Antibody (NBP1-55089) (0)

There are no reviews for VPS37A Antibody (NBP1-55089). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS37A Antibody (NBP1-55089) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional VPS37A Products

Bioinformatics Tool for VPS37A Antibody (NBP1-55089)

Discover related pathways, diseases and genes to VPS37A Antibody (NBP1-55089). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS37A Antibody (NBP1-55089)

Discover more about diseases related to VPS37A Antibody (NBP1-55089).

Pathways for VPS37A Antibody (NBP1-55089)

View related products by pathway.

PTMs for VPS37A Antibody (NBP1-55089)

Learn more about PTMs related to VPS37A Antibody (NBP1-55089).

Blogs on VPS37A

There are no specific blogs for VPS37A, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VPS37A Antibody and receive a gift card or discount.


Gene Symbol VPS37A