VPS33A Antibody

Images

 
Western Blot: VPS33A Antibody [NBP2-86895] - Host: Rabbit. Target Name: VPS33A. Sample Type: 721_B whole cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS33A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human VPS33A. Peptide sequence: TYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
VPS33A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS33A Antibody

  • FLJ22395
  • FLJ23187
  • hVPS33A
  • vacuolar protein sorting 33 homolog A (S. cerevisiae)
  • vacuolar protein sorting 33A (yeast)
  • vacuolar protein sorting 33A
  • vacuolar protein sorting-associated protein 33A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-04674
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27135
Species: Hu
Applications: PEP-ELISA
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94816
Species: Hu, Mu
Applications: ICC/IF, WB
H00011234-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00055330-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-38904
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
9094-AG
Species: Hu
Applications: BA
NBP2-14100
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89901
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
AF6457
Species: Hu
Applications: WB
NBP2-20157
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
AF4764
Species: Hu
Applications: ICC, IHC, WB

Publications for VPS33A Antibody (NBP2-86895) (0)

There are no publications for VPS33A Antibody (NBP2-86895).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS33A Antibody (NBP2-86895) (0)

There are no reviews for VPS33A Antibody (NBP2-86895). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS33A Antibody (NBP2-86895) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional VPS33A Products

Bioinformatics Tool for VPS33A Antibody (NBP2-86895)

Discover related pathways, diseases and genes to VPS33A Antibody (NBP2-86895). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS33A Antibody (NBP2-86895)

Discover more about diseases related to VPS33A Antibody (NBP2-86895).
 

Pathways for VPS33A Antibody (NBP2-86895)

View related products by pathway.

Blogs on VPS33A

There are no specific blogs for VPS33A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS33A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS33A