VPS28 Antibody

Images

 
Western Blot: VPS28 Antibody [NBP1-54735] - Positive Control: Lane 1: 20 ug mouse brain extract Lane 2: 20 ug mouse brain extract Primary Antibody Dilution : 1:500 Secondary Antibody : Anti rabbit-HRP Secondry Antibody ...read more
Western Blot: VPS28 Antibody [NBP1-54735] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Product Details

Summary
Product Discontinued
View other related VPS28 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54735
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

VPS28 Antibody Summary

Immunogen
Synthetic peptides corresponding to VPS28(vacuolar protein sorting 28 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS28. Peptide sequence MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ.
Clonality
Polyclonal
Host
Rabbit
Gene
VPS28
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against VPS28 and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for VPS28 Antibody

  • ESCRT-I complex subunit VPS28
  • H-Vps28
  • MGC60323
  • vacuolar protein sorting 28 (yeast)
  • vacuolar protein sorting 28 homolog (S. cerevisiae)
  • vacuolar protein sorting-associated protein 28 homolog
  • yeast class E protein Vps28p homolog

Background

This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway. The encoded protein is one of the three subunits of the ESCRT-I complex (endosomal complexes required for transport) invol

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP1-82283
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo
NBP1-83528
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91882
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NBP2-13519
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83632
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VPS28 Antibody (NBP1-54735) (0)

There are no publications for VPS28 Antibody (NBP1-54735).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS28 Antibody (NBP1-54735) (0)

There are no reviews for VPS28 Antibody (NBP1-54735). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS28 Antibody (NBP1-54735) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS28 Products

Bioinformatics Tool for VPS28 Antibody (NBP1-54735)

Discover related pathways, diseases and genes to VPS28 Antibody (NBP1-54735). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS28 Antibody (NBP1-54735)

Discover more about diseases related to VPS28 Antibody (NBP1-54735).
 

Pathways for VPS28 Antibody (NBP1-54735)

View related products by pathway.

PTMs for VPS28 Antibody (NBP1-54735)

Learn more about PTMs related to VPS28 Antibody (NBP1-54735).
 

Research Areas for VPS28 Antibody (NBP1-54735)

Find related products by research area.

Blogs on VPS28

There are no specific blogs for VPS28, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS28 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS28
Uniprot