Recombinant Human Von Willebrand Factor Protein

Images

 
SDS-Page: Recombinant Human Von Willebrand Factor Protein [H00007450-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Von Willebrand Factor Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-273 of Human VWF full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGAQDEEEGIQDLDGLLVFDKIVEVTLLNLPWYNEETEGQRGEMTAPKSPRAKIRGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKVGVDWPGCTWMVCDFWI

Protein/Peptide Type
Recombinant Protein
Gene
VWF

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Von Willebrand Factor Protein

  • coagulation factor VIII VWF
  • F8
  • F8VWF
  • von Willebrand factor
  • VWD
  • vWF

Background

The glycoprotein encoded by this gene functions as both an antihemophilic factor carrier and a platelet-vessel wall mediator in the blood coagulation system. It is crucial to the hemostasis process. Mutations in this gene or deficiencies in this protein result in von Willebrand's disease. An unprocessed pseudogene has been found on chromosome 22. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4245
Species: Hu
Applications: WB, IP
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-07799
Species: Hu
H00007450-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Von Willebrand Factor Recombinant Protein (H00007450-P01) (0)

There are no publications for Von Willebrand Factor Recombinant Protein (H00007450-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Von Willebrand Factor Recombinant Protein (H00007450-P01) (0)

There are no reviews for Von Willebrand Factor Recombinant Protein (H00007450-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Von Willebrand Factor Recombinant Protein (H00007450-P01). (Showing 1 - 1 of 1 FAQ).

  1. I am working on thrombotic diseases and I intend to use VWF in my study. Please, can I know how much the activity (Ristocitin cofactor activity) for your VWF?
    • H00007450-P01 is produced by a Taiwanese company called Abnova and we distribute it for them. They do not test the activity of their recombinant proteins. The proteins are produced in a cell-free wheat germ system with an N-terminal 26kDa GST-tag. Due to this expression system, in our experience, the proteins do not always undergo the same folding and post-transnational modifications they might undergo in an endogenous cell. Because of this, we do not recommend this protein for use in functional assays and do not guarantee them for this use. They are mainly intended for use in Western Blots as a positive control with their antibody.

Additional Von Willebrand Factor Products

Bioinformatics Tool for Von Willebrand Factor Recombinant Protein (H00007450-P01)

Discover related pathways, diseases and genes to Von Willebrand Factor Recombinant Protein (H00007450-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Von Willebrand Factor Recombinant Protein (H00007450-P01)

Discover more about diseases related to Von Willebrand Factor Recombinant Protein (H00007450-P01).
 

Pathways for Von Willebrand Factor Recombinant Protein (H00007450-P01)

View related products by pathway.

PTMs for Von Willebrand Factor Recombinant Protein (H00007450-P01)

Learn more about PTMs related to Von Willebrand Factor Recombinant Protein (H00007450-P01).
 

Research Areas for Von Willebrand Factor Recombinant Protein (H00007450-P01)

Find related products by research area.

Blogs on Von Willebrand Factor.

Thrombomodulin - A multifunctional protein with roles in inflammation and coagulation
Thrombomodulin, also known as BDCA-3, is a glycosylated transmembrane protein present on the surface of vascular endothelial cells. Thrombomodulin is a high-affinity receptor for thrombin, a key protein in the coagulation cascade. Formation of the...  Read full blog post.

Von Willebrand Factor: An important mediator and carrier of hemostasis
Human Von Willebrand Factor (factor VIII R: Ag) is a 270 kDa multimeric plasma gylcoprotein. Important in the maintenance of hemostasis, it mediates platelet adhesion to injured vessel walls and serves as a carrier and stabilizer for coagulation facto...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Von Willebrand Factor Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VWF