Von Willebrand Factor Antibody (1A11)

Images

 
Western Blot: Von Willebrand Factor Antibody (1A11) [H00007450-M02] - Analysis of VWF expression in transfected 293T cell line by VWF monoclonal antibody (M02), clone 1A11.Lane 1: VWF transfected lysate(30.2 KDa).Lane ...read more
Sandwich ELISA: Von Willebrand Factor Antibody (1A11) [H00007450-M02] - Detection limit for recombinant GST tagged VWF is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Von Willebrand Factor Antibody (1A11) Summary

Immunogen
VWF (AAH22258.1, 1 a.a. - 273 a.a.) full-length human protein. MGAQDEEEGIQDLDGLLVFDKIVEVTLLNLPWYNEETEGQRGEMTAPKSPRAKIRGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKVGVDWPGCTWMVCDFWI
Marker
Endothelial Cell Marker
Specificity
Reacts with von Willebrand factor.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VWF
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Von Willebrand Factor Antibody (1A11)

  • coagulation factor VIII VWF
  • F8
  • F8VWF
  • von Willebrand factor
  • VWD
  • vWF

Background

The glycoprotein encoded by this gene functions as both an antihemophilic factor carrier and a platelet-vessel wall mediator in the blood coagulation system. It is crucial to the hemostasis process. Mutations in this gene or deficiencies in this protein result in von Willebrand's disease. An unprocessed pseudogene has been found on chromosome 22. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4245
Species: Hu
Applications: WB, IP
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-07799
Species: Hu
H00007450-M02
Species: Hu
Applications: WB, ELISA

Publications for Von Willebrand Factor Antibody (H00007450-M02) (0)

There are no publications for Von Willebrand Factor Antibody (H00007450-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Von Willebrand Factor Antibody (H00007450-M02) (0)

There are no reviews for Von Willebrand Factor Antibody (H00007450-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Von Willebrand Factor Antibody (H00007450-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Von Willebrand Factor Products

Bioinformatics Tool for Von Willebrand Factor Antibody (H00007450-M02)

Discover related pathways, diseases and genes to Von Willebrand Factor Antibody (H00007450-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Von Willebrand Factor Antibody (H00007450-M02)

Discover more about diseases related to Von Willebrand Factor Antibody (H00007450-M02).
 

Pathways for Von Willebrand Factor Antibody (H00007450-M02)

View related products by pathway.

PTMs for Von Willebrand Factor Antibody (H00007450-M02)

Learn more about PTMs related to Von Willebrand Factor Antibody (H00007450-M02).
 

Research Areas for Von Willebrand Factor Antibody (H00007450-M02)

Find related products by research area.

Blogs on Von Willebrand Factor.

Thrombomodulin - A multifunctional protein with roles in inflammation and coagulation
Thrombomodulin, also known as BDCA-3, is a glycosylated transmembrane protein present on the surface of vascular endothelial cells. Thrombomodulin is a high-affinity receptor for thrombin, a key protein in the coagulation cascade. Formation of the...  Read full blog post.

Von Willebrand Factor: An important mediator and carrier of hemostasis
Human Von Willebrand Factor (factor VIII R: Ag) is a 270 kDa multimeric plasma gylcoprotein. Important in the maintenance of hemostasis, it mediates platelet adhesion to injured vessel walls and serves as a carrier and stabilizer for coagulation facto...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Von Willebrand Factor Antibody (1A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol VWF
Entrez
Uniprot