Von Hippel Lindau Antibody (1G12) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related Von Hippel Lindau Primary Antibodies

Order Details


    • Catalog Number
      H00007428-M01V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Von Hippel Lindau Antibody (1G12) [DyLight 405] Summary

Immunogen
VHL (NP_000542, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIH
Specificity
VHL - von Hippel-Lindau tumor suppressor
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VHL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Von Hippel Lindau Antibody (1G12) [DyLight 405]

  • elongin binding protein
  • HRCA1
  • Protein G7
  • pVHL
  • RCA1
  • VHL1
  • von Hippel-Lindau disease tumor suppressor
  • von Hippel-Lindau syndrome
  • von Hippel-Lindau tumor suppressor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-92372
Species: Hu
Applications: IHC, IHC-P
NBP2-02280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87544
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP

Publications for Von Hippel Lindau Antibody (H00007428-M01V) (0)

There are no publications for Von Hippel Lindau Antibody (H00007428-M01V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Von Hippel Lindau Antibody (H00007428-M01V) (0)

There are no reviews for Von Hippel Lindau Antibody (H00007428-M01V). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Von Hippel Lindau Antibody (H00007428-M01V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Von Hippel Lindau Products

Bioinformatics Tool for Von Hippel Lindau Antibody (H00007428-M01V)

Discover related pathways, diseases and genes to Von Hippel Lindau Antibody (H00007428-M01V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Von Hippel Lindau Antibody (H00007428-M01V)

Discover more about diseases related to Von Hippel Lindau Antibody (H00007428-M01V).
 

Pathways for Von Hippel Lindau Antibody (H00007428-M01V)

View related products by pathway.

PTMs for Von Hippel Lindau Antibody (H00007428-M01V)

Learn more about PTMs related to Von Hippel Lindau Antibody (H00007428-M01V).
 

Research Areas for Von Hippel Lindau Antibody (H00007428-M01V)

Find related products by research area.

Blogs on Von Hippel Lindau

There are no specific blogs for Von Hippel Lindau, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Von Hippel Lindau Antibody (1G12) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol VHL