Vomeronasal 1 receptor 54 Antibody

Images

 
Western Blot: Vomeronasal 1 receptor 54 Antibody [NBP3-10245] - Western blot analysis of Vomeronasal 1 receptor 54 in Mouse Brain lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Vomeronasal 1 receptor 54 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Vomeronasal 1 receptor 54 (NP_444454.1). Peptide sequence NKMNRLSHNTEIRNAIYSGVGIGISGNSFLLLFHIFKYIRGQRSRHIDLP
Clonality
Polyclonal
Host
Rabbit
Gene
Vmn1r54
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for Vomeronasal 1 receptor 54 Antibody

  • V1
  • V1ra9
  • VN7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF009
Species: Hu
Applications: IHC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-68928
Species: Hu
Applications: IHC, IHC-P
7268-CT
Species: Hu
Applications: BA
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IM, IP, KD, WB
NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
2308-VN
Species: Hu
Applications: BA
AF245
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF2005
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
AF7388
Species: Hu
Applications: IHC
NBP3-10245
Species: Mu
Applications: WB

Publications for Vomeronasal 1 receptor 54 Antibody (NBP3-10245) (0)

There are no publications for Vomeronasal 1 receptor 54 Antibody (NBP3-10245).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vomeronasal 1 receptor 54 Antibody (NBP3-10245) (0)

There are no reviews for Vomeronasal 1 receptor 54 Antibody (NBP3-10245). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vomeronasal 1 receptor 54 Antibody (NBP3-10245) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Vomeronasal 1 receptor 54 Products

Bioinformatics Tool for Vomeronasal 1 receptor 54 Antibody (NBP3-10245)

Discover related pathways, diseases and genes to Vomeronasal 1 receptor 54 Antibody (NBP3-10245). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Vomeronasal 1 receptor 54

There are no specific blogs for Vomeronasal 1 receptor 54, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Vomeronasal 1 receptor 54 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol Vmn1r54