VNN2 Antibody

Images

 
Immunohistochemistry: VNN2 Antibody [NBP2-31906] - Staining of pancreas.
Immunohistochemistry: VNN2 Antibody [NBP2-31906] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry: VNN2 Antibody [NBP2-31906] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Product Discontinued
View other related VNN2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-31906
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

VNN2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LLLSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTVC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VNN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VNN2 Antibody

  • EC 3.5.1
  • EC 3.5.1.92
  • FOAP-4
  • Glycosylphosphatidyl inositol-anchored protein GPI-80
  • GPI-80 variant protein 1
  • GPI-80 variant protein 2
  • GPI-80 variant protein 3
  • GPI-80 variant protein 4
  • GPI-80
  • pantetheinase
  • Protein FOAP-4
  • vanin 2
  • vanin-2
  • Vannin 2
  • vascular non-inflammatory molecule 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7999-AH
Species: Hu
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14891
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-83201
Species: Hu
Applications: IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-31906
Species: Hu
Applications: IHC, IHC-P

Publications for VNN2 Antibody (NBP2-31906) (0)

There are no publications for VNN2 Antibody (NBP2-31906).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VNN2 Antibody (NBP2-31906) (0)

There are no reviews for VNN2 Antibody (NBP2-31906). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VNN2 Antibody (NBP2-31906) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VNN2 Products

Bioinformatics Tool for VNN2 Antibody (NBP2-31906)

Discover related pathways, diseases and genes to VNN2 Antibody (NBP2-31906). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VNN2 Antibody (NBP2-31906)

Discover more about diseases related to VNN2 Antibody (NBP2-31906).
 

Pathways for VNN2 Antibody (NBP2-31906)

View related products by pathway.

PTMs for VNN2 Antibody (NBP2-31906)

Learn more about PTMs related to VNN2 Antibody (NBP2-31906).

Blogs on VNN2

There are no specific blogs for VNN2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VNN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VNN2
Uniprot