Recombinant Human VIP R1/VPAC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human VIP R1/VPAC1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 393-457 of Human VIPR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GEVQAELRRKWRRWHLQGVLGWNPKYRHPSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
VIPR1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VIP R1/VPAC1 Protein

  • FLJ41949
  • HVR1
  • II
  • PACAP type II receptor
  • PACAP-R2
  • RDC1
  • type II
  • V1RG
  • vasoactive intestinal peptide receptor 1
  • vasoactive intestinal polypeptide receptor 1
  • VIP R1
  • VIP receptor, type I
  • VIPR
  • VIPR1
  • VPAC1
  • VPAC1R

Background

VIPR1 - vasoactive intestinal peptide receptor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6380
Species: Mu
Applications: WB
MAB5416
Species: Hu
Applications: IHC
NBP1-31619
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NLS948
Species: Hu, Bt, Ca, Ch, Mk, Pm, Xp
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3499
Species: Hu
Applications: WB
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-24779
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P
NBP1-31293
Species: Hu, Mu
Applications: WB, ICC/IF
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-48988
Species: Hu
Applications: IHC
H00007433-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for VIP R1/VPAC1 Partial Recombinant Protein (H00007433-Q01) (0)

There are no publications for VIP R1/VPAC1 Partial Recombinant Protein (H00007433-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VIP R1/VPAC1 Partial Recombinant Protein (H00007433-Q01) (0)

There are no reviews for VIP R1/VPAC1 Partial Recombinant Protein (H00007433-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VIP R1/VPAC1 Partial Recombinant Protein (H00007433-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VIP R1/VPAC1 Products

Bioinformatics Tool for VIP R1/VPAC1 Partial Recombinant Protein (H00007433-Q01)

Discover related pathways, diseases and genes to VIP R1/VPAC1 Partial Recombinant Protein (H00007433-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VIP R1/VPAC1 Partial Recombinant Protein (H00007433-Q01)

Discover more about diseases related to VIP R1/VPAC1 Partial Recombinant Protein (H00007433-Q01).
 

Pathways for VIP R1/VPAC1 Partial Recombinant Protein (H00007433-Q01)

View related products by pathway.

PTMs for VIP R1/VPAC1 Partial Recombinant Protein (H00007433-Q01)

Learn more about PTMs related to VIP R1/VPAC1 Partial Recombinant Protein (H00007433-Q01).
 

Research Areas for VIP R1/VPAC1 Partial Recombinant Protein (H00007433-Q01)

Find related products by research area.

Blogs on VIP R1/VPAC1

There are no specific blogs for VIP R1/VPAC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VIP R1/VPAC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VIPR1
Entrez