VEGF R3/Flt-4 Antibody (5F11)

Images

 
Sandwich ELISA: VEGF R3/Flt-4 Antibody (5F11) [H00002324-M02] - Detection limit for recombinant GST tagged FLT4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related VEGF R3/Flt-4 Primary Antibodies

Order Details


    • Catalog Number
      H00002324-M02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

VEGF R3/Flt-4 Antibody (5F11) Summary

Immunogen
FLT4 (NP_002011, 34 a.a. - 133 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR
Specificity
FLT4 - fms-related tyrosine kinase 4
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FLT4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VEGF R3/Flt-4 Antibody (5F11)

  • EC 2.7.10
  • EC 2.7.10.1
  • FLT4
  • Flt-4
  • fms-related tyrosine kinase 4
  • LMPH1A
  • PCLFLT41
  • soluble VEGFR3 variant 1
  • soluble VEGFR3 variant 2
  • soluble VEGFR3 variant 3
  • Tyrosine-protein kinase receptor FLT4
  • vascular endothelial growth factor receptor 3
  • VEGF R3
  • VEGFR3
  • VEGFR-3
  • VEGFR3Fms-like tyrosine kinase 4

Background

This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
AF2125
Species: Mu
Applications: WB, IHC
NB600-1015
Species: Mu, Hu(-)
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
MAB7265
Species: Mu
Applications: WB, IHC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
H00002324-M02
Species: Hu
Applications: WB, ELISA

Publications for VEGF R3/Flt-4 Antibody (H00002324-M02) (0)

There are no publications for VEGF R3/Flt-4 Antibody (H00002324-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VEGF R3/Flt-4 Antibody (H00002324-M02) (0)

There are no reviews for VEGF R3/Flt-4 Antibody (H00002324-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VEGF R3/Flt-4 Antibody (H00002324-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VEGF R3/Flt-4 Products

Bioinformatics Tool for VEGF R3/Flt-4 Antibody (H00002324-M02)

Discover related pathways, diseases and genes to VEGF R3/Flt-4 Antibody (H00002324-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VEGF R3/Flt-4 Antibody (H00002324-M02)

Discover more about diseases related to VEGF R3/Flt-4 Antibody (H00002324-M02).
 

Pathways for VEGF R3/Flt-4 Antibody (H00002324-M02)

View related products by pathway.

PTMs for VEGF R3/Flt-4 Antibody (H00002324-M02)

Learn more about PTMs related to VEGF R3/Flt-4 Antibody (H00002324-M02).
 

Research Areas for VEGF R3/Flt-4 Antibody (H00002324-M02)

Find related products by research area.

Blogs on VEGF R3/Flt-4

There are no specific blogs for VEGF R3/Flt-4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VEGF R3/Flt-4 Antibody (5F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol FLT4
Entrez
OMIM
Uniprot