VEGF-B Antibody (4H5)

Images

 
Immunoprecipitation: VEGF-B Antibody (4H5) [H00007423-M03] - Analysis of VEGFB transfected lysate using anti-VEGFB monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with VEGFB rabbit polyclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
4H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VEGF-B Antibody (4H5) Summary

Immunogen
VEGFB (NP_003368, 27 a.a. - 136 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPD
Specificity
VEGFB (4H5)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VEGFB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VEGF-B Antibody (4H5)

  • vascular endothelial growth factor B
  • VEGFB
  • VEGF-B
  • VEGF-related factor
  • VRFVEGFL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00007423-M03
Species: Hu
Applications: WB, ELISA, IP

Publications for VEGF-B Antibody (H00007423-M03) (0)

There are no publications for VEGF-B Antibody (H00007423-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VEGF-B Antibody (H00007423-M03) (0)

There are no reviews for VEGF-B Antibody (H00007423-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VEGF-B Antibody (H00007423-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VEGF-B Products

Bioinformatics Tool for VEGF-B Antibody (H00007423-M03)

Discover related pathways, diseases and genes to VEGF-B Antibody (H00007423-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VEGF-B Antibody (H00007423-M03)

Discover more about diseases related to VEGF-B Antibody (H00007423-M03).
 

Pathways for VEGF-B Antibody (H00007423-M03)

View related products by pathway.

PTMs for VEGF-B Antibody (H00007423-M03)

Learn more about PTMs related to VEGF-B Antibody (H00007423-M03).
 

Research Areas for VEGF-B Antibody (H00007423-M03)

Find related products by research area.

Blogs on VEGF-B

There are no specific blogs for VEGF-B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VEGF-B Antibody (4H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol VEGFB
Entrez
OMIM
Uniprot