Recombinant Mouse VEGF 121 Protein

Images

 
There are currently no images for VEGF 121 Protein (NBP1-99304).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications PAGE, HPLC
Concentration
Lyoph

Order Details

Recombinant Mouse VEGF 121 Protein Summary

Description
Recombinant bioactive protein for Mouse VEGF 121

Source:E. coli
Amino Acid Sequence:(Q00731) - MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR

Preparation
Method
>97% SDS-PAGE
Details of Functionality
The activity as determined by dose-dependent proliferation of human umbilical vein endothelial cells (HUVEC) was typically found to be 1-5 ng/ml.
Source
E. coli
Protein/Peptide Type
Biologically Active Protein
Gene
VEGFA
Purity
>95%, by SDS-PAGE
Endotoxin Note
<0.1 ng/ug

Applications/Dilutions

Theoretical MW
28.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20 to -80C. Avoid freeze-thaw cycles.
Buffer
Sterile filtered and lyophilized with no additives
Concentration
Lyoph
Purity
>95%, by SDS-PAGE
Reconstitution Instructions
Reconstitute the lyophilized product with sterile H2O at a concentration of 0.1 - 0.5 mg/ml, which can be further diluted into other aqueous solutions

Alternate Names for Recombinant Mouse VEGF 121 Protein

  • MVCD1
  • vascular endothelial growth factor A
  • Vascular permeability factor
  • VEGF-A
  • VEGFMGC70609
  • VPFvascular endothelial growth factor

Background

Recombinant Mouse VEGF-121 is a truncated version of Mouse VEGF-165. Mouse VEGF-121 is a homodimer with a molecular weight of 28.2 kDa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 2 years from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-99304
Species: Mu
Applications: PAGE, HPLC

Publications for VEGF 121 Protein (NBP1-99304) (0)

There are no publications for VEGF 121 Protein (NBP1-99304).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VEGF 121 Protein (NBP1-99304) (0)

There are no reviews for VEGF 121 Protein (NBP1-99304). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for VEGF 121 Protein (NBP1-99304) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VEGF 121 Products

VEGF 121 NBP1-99304

Bioinformatics Tool for VEGF 121 Protein (NBP1-99304)

Discover related pathways, diseases and genes to VEGF 121 Protein (NBP1-99304). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VEGF 121 Protein (NBP1-99304)

Discover more about diseases related to VEGF 121 Protein (NBP1-99304).
 

Pathways for VEGF 121 Protein (NBP1-99304)

View related products by pathway.

PTMs for VEGF 121 Protein (NBP1-99304)

Learn more about PTMs related to VEGF 121 Protein (NBP1-99304).

Blogs on VEGF 121

There are no specific blogs for VEGF 121, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Mouse VEGF 121 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VEGFA