VDR/NR1I1/Vitamin D Receptor Antibody


Western Blot: Vitamin D Receptor Antibody [NBP1-52819] - Human Small Intestine, concentration 0.2-1 ug/ml.

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

VDR/NR1I1/Vitamin D Receptor Antibody Summary

Synthetic peptides corresponding to VDR(vitamin D (1,25- dihydroxyvitamin D3) receptor) The peptide sequence was selected from the N terminal of VDR. Peptide sequence ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against VDR and was validated on Western blot.
Positive Control
VDR/NR1I1/Vitamin D Receptor Lysate (NBP2-66116)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for VDR/NR1I1/Vitamin D Receptor Antibody

  • NR1I1
  • NR1I1Nuclear receptor subfamily 1 group I member 11,25-dihydroxyvitamin D3 receptor
  • VDR
  • vitamin D1,25- dihydroxyvitamin D3 receptor
  • vitamin D3 receptor


VDR is the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarit


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VDR/NR1I1/Vitamin D Receptor Antibody (NBP1-52819) (0)

There are no publications for VDR/NR1I1/Vitamin D Receptor Antibody (NBP1-52819).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VDR/NR1I1/Vitamin D Receptor Antibody (NBP1-52819) (0)

There are no reviews for VDR/NR1I1/Vitamin D Receptor Antibody (NBP1-52819). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VDR/NR1I1/Vitamin D Receptor Antibody (NBP1-52819) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional VDR/NR1I1/Vitamin D Receptor Products

Bioinformatics Tool for VDR/NR1I1/Vitamin D Receptor Antibody (NBP1-52819)

Discover related pathways, diseases and genes to VDR/NR1I1/Vitamin D Receptor Antibody (NBP1-52819). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VDR/NR1I1/Vitamin D Receptor Antibody (NBP1-52819)

Discover more about diseases related to VDR/NR1I1/Vitamin D Receptor Antibody (NBP1-52819).

Pathways for VDR/NR1I1/Vitamin D Receptor Antibody (NBP1-52819)

View related products by pathway.

PTMs for VDR/NR1I1/Vitamin D Receptor Antibody (NBP1-52819)

Learn more about PTMs related to VDR/NR1I1/Vitamin D Receptor Antibody (NBP1-52819).

Blogs on VDR/NR1I1/Vitamin D Receptor

There are no specific blogs for VDR/NR1I1/Vitamin D Receptor, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VDR/NR1I1/Vitamin D Receptor Antibody and receive a gift card or discount.


Gene Symbol VDR