Vav-1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Vav-1 Antibody [NBP1-86867] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Analysis in human lymph node and pancreas tissues Corresponding VAV1 RNA-seq data are presented for the same tissues.

Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: Vav-1 Antibody [NBP1-86867] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Vav-1 Antibody [NBP1-86867] - Staining of human skeletal muscle shows no positivity in myoctes as expected.

Immunohistochemistry-Paraffin: Vav-1 Antibody [NBP1-86867] - Staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Vav-1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Vav-1 Antibody - BSA Free (NBP1-86867) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEAL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VAV1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Vav-1 Recombinant Protein Antigen (NBP1-86867PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Vav-1 Antibody - BSA Free

• oncogene vav
• proto-oncogene vav
• vav 1 guanine nucleotide exchange factor
• vav proto-oncogene
• Vav1
• Vav-1
• vav-T
• VAVvav 1 oncogene

Background

The Vav family are Rho/Rac guanosine nucleotide exchange factors (GEFs), consisting of three members in mammalian cells (Vav, Vav2, Vav3) and one in nematodes (CelVav) (1). First discovered based on its transforming properties, Vav is expressed mainly in hematopoietic cells and a few non-hematopoietic tissues, such as the pancreas and tooth enamels (2). As a signaling transducer, Vav is involved in T-cell activated transduction of T-cell antigen receptor (TCR). T-cell stimulated and tyrosine phosphorylated Vav acts as a catalyst in the exchange of guanosine nucleotides on Rac-1, a GTP binding protein (3). Using a mouse model, Vav expression has been determined to play an essential role in the cyctosketetal, proliferative, and apoptotic pathways for developing lymphoid cells and its signal response (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VAV1