Vav-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Vav-1 Antibody [NBP1-86867] - Staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Vav-1 Antibody [NBP1-86867] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells and germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Vav-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VAV1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Vav-1 Recombinant Protein Antigen (NBP1-86867PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Vav-1 Antibody

  • oncogene vav
  • proto-oncogene vav
  • vav 1 guanine nucleotide exchange factor
  • vav proto-oncogene
  • Vav1
  • Vav-1
  • vav-T
  • VAVvav 1 oncogene

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-27078
Species: Hu, Ca, Pm
Applications: WB
MAB7500
Species: Hu
Applications: WB, ICC
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P

Publications for Vav-1 Antibody (NBP1-86867) (0)

There are no publications for Vav-1 Antibody (NBP1-86867).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vav-1 Antibody (NBP1-86867) (0)

There are no reviews for Vav-1 Antibody (NBP1-86867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Vav-1 Antibody (NBP1-86867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Vav-1 Products

Bioinformatics Tool for Vav-1 Antibody (NBP1-86867)

Discover related pathways, diseases and genes to Vav-1 Antibody (NBP1-86867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vav-1 Antibody (NBP1-86867)

Discover more about diseases related to Vav-1 Antibody (NBP1-86867).
 

Pathways for Vav-1 Antibody (NBP1-86867)

View related products by pathway.

PTMs for Vav-1 Antibody (NBP1-86867)

Learn more about PTMs related to Vav-1 Antibody (NBP1-86867).
 

Research Areas for Vav-1 Antibody (NBP1-86867)

Find related products by research area.

Blogs on Vav-1

There are no specific blogs for Vav-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Vav-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VAV1
Entrez