VASH2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: VASH2 Antibody [NBP2-13514] - Staining of human cell line HEK 293 shows positivity in positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: VASH2 Antibody [NBP2-13514] Staining of human colon shows strong cytoplasmic positivity in glandular cells and moderate staining in endothelial cells.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

VASH2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQV RSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VASH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.

Alternate Names for VASH2 Antibody

  • FLJ12505
  • RP11-275G3.1
  • VASHL
  • vasohibin 2
  • vasohibin-2
  • Vasohibin-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82944
Species: Hu
Applications: WB, IHC, IHC-P
AF313
Species: Hu
Applications: WB, Simple Western, IHC, Block
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, TCS, LA
AF619
Species: Hu
Applications: WB, Flow, IHC
MAB225R
Species: Hu
Applications: Flow, Neut

Publications for VASH2 Antibody (NBP2-13514) (0)

There are no publications for VASH2 Antibody (NBP2-13514).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VASH2 Antibody (NBP2-13514) (0)

There are no reviews for VASH2 Antibody (NBP2-13514). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for VASH2 Antibody (NBP2-13514) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VASH2 Antibody Products

VASH2 NBP2-13514

Related Products by Gene

Bioinformatics Tool for VASH2 Antibody (NBP2-13514)

Discover related pathways, diseases and genes to VASH2 Antibody (NBP2-13514). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VASH2 Antibody (NBP2-13514)

Discover more about diseases related to VASH2 Antibody (NBP2-13514).
 

Pathways for VASH2 Antibody (NBP2-13514)

View related products by pathway.

Blogs on VASH2

There are no specific blogs for VASH2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol VASH2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-13514 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought