Vanilloid R1/TRPV1 Antibody (1A8)

Images

 
Western Blot: Vanilloid R1/TRPV1 Antibody (1A8) [H00007442-M02] - TRPV1 monoclonal antibody (M02), clone 1A8. Analysis of TRPV1 expression in rat thymus.
ELISA: Vanilloid R1/TRPV1 Antibody (1A8) [H00007442-M02] - Detection limit for recombinant GST tagged TRPV1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
1A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Vanilloid R1/TRPV1 Antibody (1A8) Summary

Immunogen
TRPV1 (NP_542437, 21 a.a. - 124 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRPV1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.
Publications
Read Publications using H00007442-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Vanilloid R1/TRPV1 Antibody (1A8)

  • Capsaicin Receptor
  • Osm-9-like TRP channel 1
  • OTRPC1
  • transient receptor potential cation channel subfamily V member 1
  • transient receptor potential cation channel, subfamily V, member 1
  • transient receptor potential vanilloid 1a
  • transient receptor potential vanilloid 1b
  • TRPV1
  • Vanilloid R1
  • Vanilloid receptor 1
  • vanilloid receptor subtype 1
  • VanilloidR1
  • VR1
  • VR1DKFZp434K0220

Background

Capsaicin, the main pungent ingredient in hot chili peppers, elicits a sensation of burning pain by selectively activating sensory neurons that convey information about noxious stimuli to the central nervous system. The protein encoded by this gene is a receptor for capsaicin and is a non-selective cation channel that is structurally related to members of the TRP family of ion channels. This receptor is also activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40763
Species: Hu, Mu, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP1-32096
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-97311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74960
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
MAB4077
Species: Hu
Applications: WB, IHC
AF1396
Species: Hu
Applications: WB
NB300-606
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-12909
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Vanilloid R1/TRPV1 Antibody (H00007442-M02)(2)

Reviews for Vanilloid R1/TRPV1 Antibody (H00007442-M02) (0)

There are no reviews for Vanilloid R1/TRPV1 Antibody (H00007442-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vanilloid R1/TRPV1 Antibody (H00007442-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Vanilloid R1/TRPV1 Products

Bioinformatics Tool for Vanilloid R1/TRPV1 Antibody (H00007442-M02)

Discover related pathways, diseases and genes to Vanilloid R1/TRPV1 Antibody (H00007442-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vanilloid R1/TRPV1 Antibody (H00007442-M02)

Discover more about diseases related to Vanilloid R1/TRPV1 Antibody (H00007442-M02).
 

Pathways for Vanilloid R1/TRPV1 Antibody (H00007442-M02)

View related products by pathway.

PTMs for Vanilloid R1/TRPV1 Antibody (H00007442-M02)

Learn more about PTMs related to Vanilloid R1/TRPV1 Antibody (H00007442-M02).
 

Research Areas for Vanilloid R1/TRPV1 Antibody (H00007442-M02)

Find related products by research area.

Blogs on Vanilloid R1/TRPV1

There are no specific blogs for Vanilloid R1/TRPV1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Vanilloid R1/TRPV1 Antibody (1A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPV1
Entrez
Uniprot