VAMP-7 Antibody

Images

 
Western Blot: VAMP-7 Antibody [NBP1-79232] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related VAMP-7 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-79232
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

VAMP-7 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human VAMP7The immunogen for this antibody is VAMP7. Peptide sequence KIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKK.
Clonality
Polyclonal
Host
Rabbit
Gene
VAMP7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against VAMP7 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for VAMP-7 Antibody

  • FLJ54296
  • SYBL1
  • SYBL1FLJ53762
  • synaptobrevin-like 1
  • Synaptobrevin-like protein 1
  • tetanus neurotoxin-insensitive VAMP
  • Tetanus-insensitive VAMP
  • TIVAMP
  • TI-VAMP
  • VAMP7
  • VAMP-7
  • VAMP-7FLJ53045
  • vesicle-associated membrane protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NB300-595
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5354
Species: Hu
Applications: WB, IHC
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87439
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-86984
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-50030
Species: Hu
Applications: WB, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-87497
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-79232
Species: Hu
Applications: WB

Publications for VAMP-7 Antibody (NBP1-79232) (0)

There are no publications for VAMP-7 Antibody (NBP1-79232).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VAMP-7 Antibody (NBP1-79232) (0)

There are no reviews for VAMP-7 Antibody (NBP1-79232). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VAMP-7 Antibody (NBP1-79232) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for VAMP-7 Antibody (NBP1-79232)

Discover related pathways, diseases and genes to VAMP-7 Antibody (NBP1-79232). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VAMP-7 Antibody (NBP1-79232)

Discover more about diseases related to VAMP-7 Antibody (NBP1-79232).
 

Pathways for VAMP-7 Antibody (NBP1-79232)

View related products by pathway.

PTMs for VAMP-7 Antibody (NBP1-79232)

Learn more about PTMs related to VAMP-7 Antibody (NBP1-79232).
 

Research Areas for VAMP-7 Antibody (NBP1-79232)

Find related products by research area.

Blogs on VAMP-7

There are no specific blogs for VAMP-7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VAMP-7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VAMP7
Uniprot