VAMP-1 Antibody (5A4) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related VAMP-1 Primary Antibodies

Order Details


    • Catalog Number
      H00006843-M02PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

VAMP-1 Antibody (5A4) [PerCP] Summary

Immunogen
VAMP1 (NP_055046, 28 a.a. - 96 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCK
Specificity
VAMP1 (5A4)
Isotype
IgG2a Lambda
Clonality
Monoclonal
Host
Mouse
Gene
VAMP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VAMP-1 Antibody (5A4) [PerCP]

  • DKFZp686H12131
  • SYB1
  • SYB1vesicle-associated membrane protein 1
  • synaptobrevin 1
  • Synaptobrevin-1
  • VAMP1
  • VAMP-1
  • VAMP-1synaptobrevin-1
  • vesicle-associated membrane protein 1 (synaptobrevin 1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-15855
Species: Hu, Mu, Rt, Bv
Applications: WB
AF5085
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB6117
Species: Hu
Applications: WB, IHC
NBP2-46628
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-86101
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for VAMP-1 Antibody (H00006843-M02PCP) (0)

There are no publications for VAMP-1 Antibody (H00006843-M02PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VAMP-1 Antibody (H00006843-M02PCP) (0)

There are no reviews for VAMP-1 Antibody (H00006843-M02PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VAMP-1 Antibody (H00006843-M02PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VAMP-1 Products

Bioinformatics Tool for VAMP-1 Antibody (H00006843-M02PCP)

Discover related pathways, diseases and genes to VAMP-1 Antibody (H00006843-M02PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VAMP-1 Antibody (H00006843-M02PCP)

Discover more about diseases related to VAMP-1 Antibody (H00006843-M02PCP).
 

Pathways for VAMP-1 Antibody (H00006843-M02PCP)

View related products by pathway.

PTMs for VAMP-1 Antibody (H00006843-M02PCP)

Learn more about PTMs related to VAMP-1 Antibody (H00006843-M02PCP).
 

Research Areas for VAMP-1 Antibody (H00006843-M02PCP)

Find related products by research area.

Blogs on VAMP-1

There are no specific blogs for VAMP-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VAMP-1 Antibody (5A4) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol VAMP1
Entrez