VAMP-1 Antibody (5A4) [DyLight 680]



Product Details

Product Discontinued
View other related VAMP-1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

VAMP-1 Antibody (5A4) [DyLight 680] Summary

VAMP1 (NP_055046, 28 a.a. - 96 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCK
VAMP1 (5A4)
IgG2a Lambda
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Store at 4C in the dark.
50mM Sodium Borate
0.05% Sodium Azide
IgG purified


Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VAMP-1 Antibody (5A4) [DyLight 680]

  • DKFZp686H12131
  • SYB1
  • SYB1vesicle-associated membrane protein 1
  • synaptobrevin 1
  • Synaptobrevin-1
  • VAMP1
  • VAMP-1
  • VAMP-1synaptobrevin-1
  • vesicle-associated membrane protein 1 (synaptobrevin 1)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for VAMP-1 Antibody (H00006843-M02FR) (0)

There are no publications for VAMP-1 Antibody (H00006843-M02FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VAMP-1 Antibody (H00006843-M02FR) (0)

There are no reviews for VAMP-1 Antibody (H00006843-M02FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VAMP-1 Antibody (H00006843-M02FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional VAMP-1 Products

Bioinformatics Tool for VAMP-1 Antibody (H00006843-M02FR)

Discover related pathways, diseases and genes to VAMP-1 Antibody (H00006843-M02FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VAMP-1 Antibody (H00006843-M02FR)

Discover more about diseases related to VAMP-1 Antibody (H00006843-M02FR).

Pathways for VAMP-1 Antibody (H00006843-M02FR)

View related products by pathway.

PTMs for VAMP-1 Antibody (H00006843-M02FR)

Learn more about PTMs related to VAMP-1 Antibody (H00006843-M02FR).

Research Areas for VAMP-1 Antibody (H00006843-M02FR)

Find related products by research area.

Blogs on VAMP-1

There are no specific blogs for VAMP-1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VAMP-1 Antibody (5A4) [DyLight 680] and receive a gift card or discount.


Gene Symbol VAMP1