VAC14 Antibody (3B2)

Images

 
Western Blot: VAC14 Antibody (3B2) [H00055697-M03] - Analysis of VAC14 expression in transfected 293T cell line by VAC14 monoclonal antibody (M03), clone 3B2. Lane 1: VAC14 transfected lysate (Predicted MW: 88 KDa). ...read more
Sandwich ELISA: VAC14 Antibody (3B2) [H00055697-M03] - Detection limit for recombinant GST tagged VAC14 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VAC14 Antibody (3B2) Summary

Immunogen
VAC14 (NP_060522.3, 714 a.a. ~ 782 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL
Specificity
Reacts with Vac14 homolog (S. cerevisiae).
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VAC14
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.
Control
VAC14 Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VAC14 Antibody (3B2)

  • ArPIKfyve
  • FLJ10305
  • FLJ36622
  • MGC149816
  • protein VAC14 homolog
  • Tax1 (human T-cell leukemia virus type I) binding protein 1
  • Tax1 (human T-cell leukemia virus type I) binding protein 2
  • Tax1-binding protein 2
  • TAX1BP2FLJ46582
  • TRXMGC149815
  • Vac14 homolog (S. cerevisiae)

Background

Phosphatidylinositol 3,5-bisphosphate (PI(3,5)P2) is a low-abundance signaling molecule. A regulatory complex made up of VAC14 and FIG4 (MIM 609390) control synthesis of PI(3,5)P2 by activating PI(3)P kinase, FAB1 (PIP5K3; MIM 609414). The VAC14/FIG4 complex also functions in the breakdown of PI(3,5)P2 (Zhang et al., 2007 [PubMed 17956977]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-20619
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67481
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54578
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready, KO
AF3399
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
MAB5765
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00009588-M01
Species: Hu, Bv
Applications: WB, DB, ELISA, S-ELISA
NB300-864
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01863
Species: Hu
Applications: WB, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC

Publications for VAC14 Antibody (H00055697-M03) (0)

There are no publications for VAC14 Antibody (H00055697-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VAC14 Antibody (H00055697-M03) (0)

There are no reviews for VAC14 Antibody (H00055697-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VAC14 Antibody (H00055697-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional VAC14 Products

Bioinformatics Tool for VAC14 Antibody (H00055697-M03)

Discover related pathways, diseases and genes to VAC14 Antibody (H00055697-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VAC14 Antibody (H00055697-M03)

Discover more about diseases related to VAC14 Antibody (H00055697-M03).
 

Pathways for VAC14 Antibody (H00055697-M03)

View related products by pathway.

PTMs for VAC14 Antibody (H00055697-M03)

Learn more about PTMs related to VAC14 Antibody (H00055697-M03).

Blogs on VAC14

There are no specific blogs for VAC14, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VAC14 Antibody (3B2) and receive a gift card or discount.

Bioinformatics

Gene Symbol VAC14
Entrez
Uniprot