Recombinant Human USP9x Protein

Images

 

Product Details

Summary
Product Discontinued
View other related USP9x Peptides and Proteins

Order Details


    • Catalog Number
      H00008239-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human USP9x Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 32874 of Human USP9X partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
USP9X

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human USP9x Protein

  • Deubiquitinating enzyme FAF-X
  • DFFRX
  • DFFRXubiquitin specific protease 9, X-linked (fat facets-like, Drosophila)
  • Drosophila fat facets related, X-linked
  • EC 3.1.2.15
  • EC 3.4.19.12
  • FAF
  • FAM
  • Fat facets in mammals
  • fat facets protein related, X-linked
  • Fat facets protein-related, X-linked
  • hFAM
  • probable ubiquitin carboxyl-terminal hydrolase FAF-X
  • ubiquitin specific peptidase 9, X-linked (fat facets-like, Drosophila)
  • ubiquitin specific peptidase 9, X-linked
  • ubiquitin thioesterase FAF-X
  • Ubiquitin thiolesterase FAF-X
  • ubiquitin-specific processing protease FAF-X
  • Ubiquitin-specific protease 9, X chromosome
  • Ubiquitin-specific-processing protease FAF-X
  • USP9
  • USP9x
  • X chromosome (fat facets-like Drosophila)

Background

This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-79749
Species: Hu
Applications: WB
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
NBP2-30455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF4715
Species: Mu
Applications: WB
NB100-2564
Species: Hu
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00008239-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for USP9x Partial Recombinant Protein (H00008239-Q01) (0)

There are no publications for USP9x Partial Recombinant Protein (H00008239-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP9x Partial Recombinant Protein (H00008239-Q01) (0)

There are no reviews for USP9x Partial Recombinant Protein (H00008239-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP9x Partial Recombinant Protein (H00008239-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP9x Products

Bioinformatics Tool for USP9x Partial Recombinant Protein (H00008239-Q01)

Discover related pathways, diseases and genes to USP9x Partial Recombinant Protein (H00008239-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP9x Partial Recombinant Protein (H00008239-Q01)

Discover more about diseases related to USP9x Partial Recombinant Protein (H00008239-Q01).
 

Pathways for USP9x Partial Recombinant Protein (H00008239-Q01)

View related products by pathway.

PTMs for USP9x Partial Recombinant Protein (H00008239-Q01)

Learn more about PTMs related to USP9x Partial Recombinant Protein (H00008239-Q01).

Blogs on USP9x

There are no specific blogs for USP9x, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human USP9x Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol USP9X
Entrez