USP9x Antibody (4B7)

Images

 
Immunocytochemistry/ Immunofluorescence: USP9x Antibody (4B7) [H00008239-M03] - Analysis of monoclonal antibody to USP9X on HeLa cell. Antibody concentration 10 ug/ml
ELISA: USP9x Antibody (4B7) [H00008239-M03] - Detection limit for recombinant GST tagged USP9X is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

USP9x Antibody (4B7) Summary

Immunogen
USP9X (NP_068706, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP
Specificity
USP9X - ubiquitin specific peptidase 9, X-linked (fat facets-like, Drosophila) (4B7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USP9X
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP9x Antibody (4B7)

  • Deubiquitinating enzyme FAF-X
  • DFFRX
  • DFFRXubiquitin specific protease 9, X-linked (fat facets-like, Drosophila)
  • Drosophila fat facets related, X-linked
  • EC 3.1.2.15
  • EC 3.4.19.12
  • FAF
  • FAM
  • Fat facets in mammals
  • fat facets protein related, X-linked
  • Fat facets protein-related, X-linked
  • hFAM
  • probable ubiquitin carboxyl-terminal hydrolase FAF-X
  • ubiquitin specific peptidase 9, X-linked (fat facets-like, Drosophila)
  • ubiquitin specific peptidase 9, X-linked
  • ubiquitin thioesterase FAF-X
  • Ubiquitin thiolesterase FAF-X
  • ubiquitin-specific processing protease FAF-X
  • Ubiquitin-specific protease 9, X chromosome
  • Ubiquitin-specific-processing protease FAF-X
  • USP9
  • USP9x
  • X chromosome (fat facets-like Drosophila)

Background

This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-79749
Species: Hu
Applications: WB
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
NBP2-30455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF4715
Species: Mu
Applications: WB
NB100-2564
Species: Hu
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00008239-M03
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for USP9x Antibody (H00008239-M03) (0)

There are no publications for USP9x Antibody (H00008239-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP9x Antibody (H00008239-M03) (0)

There are no reviews for USP9x Antibody (H00008239-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP9x Antibody (H00008239-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP9x Products

Bioinformatics Tool for USP9x Antibody (H00008239-M03)

Discover related pathways, diseases and genes to USP9x Antibody (H00008239-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP9x Antibody (H00008239-M03)

Discover more about diseases related to USP9x Antibody (H00008239-M03).
 

Pathways for USP9x Antibody (H00008239-M03)

View related products by pathway.

PTMs for USP9x Antibody (H00008239-M03)

Learn more about PTMs related to USP9x Antibody (H00008239-M03).

Blogs on USP9x

There are no specific blogs for USP9x, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP9x Antibody (4B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol USP9X
Entrez