USP52 Antibody (6A7) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related USP52 Primary Antibodies

Order Details


    • Catalog Number
      H00009924-M01V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

USP52 Antibody (6A7) [DyLight 405] Summary

Immunogen
USP52 (NP_055686, 1099 a.a. ~ 1199 a.a) partial recombinant protein with GST tag.TVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTAL QLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEG QTSPKNAAVFSSVLAL
Localization
Cytoplasmic and Nuclear. Note=Shuttles between nucleus and cytoplasm.
Specificity
USP52 - ubiquitin specific peptidase 52
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAN2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
DyLight 405
Format
DyLight 405 (A=400, E=420)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP52 Antibody (6A7) [DyLight 405]

  • EC 3.1.13.4
  • FLJ39360
  • hPan2
  • Inactive ubiquitin carboxyl-terminal hydrolase 52
  • KIAA0710PAB-dependent poly(A)-specific ribonuclease subunit 2
  • NALP4
  • PABP-dependent poly(A) nuclease 2
  • PAN2 poly(A) specific ribonuclease subunit homolog (S. cerevisiae)
  • PAN2 polyA specific ribonuclease subunit
  • PYPAF4
  • ubiquitin specific peptidase 52
  • ubiquitin specific protease 52
  • USP52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00025819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-13849
Species: Hu
Applications: IHC, IHC-P
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
FAB1567P
Species: Hu, Rt
Applications: Flow
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NB500-211
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IP
NBP2-46321
Species: Hu
Applications: WB, IHC
NBP1-89438
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr
NBP1-87256
Species: Hu
Applications: WB, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
AF6116
Species: Hu
Applications: WB, ICC
AF829
Species: Hu
Applications: WB
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00009924-M01V
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for USP52 Antibody (H00009924-M01V) (0)

There are no publications for USP52 Antibody (H00009924-M01V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP52 Antibody (H00009924-M01V) (0)

There are no reviews for USP52 Antibody (H00009924-M01V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP52 Antibody (H00009924-M01V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP52 Antibody (6A7) [DyLight 405] Products

Related Products by Gene

Bioinformatics Tool for USP52 Antibody (H00009924-M01V)

Discover related pathways, diseases and genes to USP52 Antibody (H00009924-M01V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP52 Antibody (H00009924-M01V)

Discover more about diseases related to USP52 Antibody (H00009924-M01V).
 

Pathways for USP52 Antibody (H00009924-M01V)

View related products by pathway.

Blogs on USP52

There are no specific blogs for USP52, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol PAN2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00009924-M01V below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.